Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2864
Gene name
LocationContig_196:31875..34911
Strand+
Gene length (bp)3036
Transcript length (bp)2916
Coding sequence length (bp)2916
Protein length (aa) 972

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05131 Pep3_Vps18 Pep3/Vps18/deep orange family 1.0E-43 288 439

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P59015|VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio GN=vps18 PE=2 SV=2 32 960 4.0E-164
sp|Q9P253|VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens GN=VPS18 PE=1 SV=2 1 960 1.0E-149
sp|Q8R307|VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus GN=Vps18 PE=1 SV=2 17 960 8.0E-147
sp|O74925|PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep3 PE=3 SV=1 33 917 4.0E-144
sp|Q24314|VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster GN=dor PE=1 SV=3 10 960 1.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P59015|VPS18_DANRE Vacuolar protein sorting-associated protein 18 homolog OS=Danio rerio GN=vps18 PE=2 SV=2 32 960 4.0E-164
sp|Q9P253|VPS18_HUMAN Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens GN=VPS18 PE=1 SV=2 1 960 1.0E-149
sp|Q8R307|VPS18_MOUSE Vacuolar protein sorting-associated protein 18 homolog OS=Mus musculus GN=Vps18 PE=1 SV=2 17 960 8.0E-147
sp|O74925|PEP3_SCHPO Vacuolar membrane protein pep3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pep3 PE=3 SV=1 33 917 4.0E-144
sp|Q24314|VPS18_DROME Vacuolar protein sorting-associated protein 18 homolog OS=Drosophila melanogaster GN=dor PE=1 SV=3 10 960 1.0E-93
sp|P27801|PEP3_YEAST Vacuolar membrane protein PEP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP3 PE=1 SV=1 36 969 3.0E-82
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2864
MAMSLDAGDGFVAAAAAASSSGLPGLGDDGIPIFTVERVQLKFSIAAEFTAAQVANNVIVLALSNGRILRIDLDR
PEDIDDIDLPRKTTDVGRIRRMFLDPTASHLLICTTSGDNYYLHSQSKHPRPLGRLRGVGIQSVAWNPSLPTAST
REILLGASDGNIYEVFIETSNEFYKKEVKHLKNLHKLPDGPITGLWVDSLDSKSDLRRVLIATQSRLFHLVGRLG
HASDGTGSVYTRLFESEQPVIHDQGRPQSNAYSTMAVTPDASEPAPSTDDGGERAYAWLCWQGILHGKLAHSPKD
NSLGSRVFSESKMMAKGQVINAESRNSLSSSIEAMALTQWHIISLVGGRVVATNRLTGKLVSEHEVLSPGQKSLG
FAVDMQKNTFWFFTPDEIYEIVVRDEDRSIWRIMMESKQYESALQHCRTAGQKETVAAAYGDHLSSKGHWTEAAS
IYGRSNKPFEDVALDMIDNNQPDALRQFLLTRLAVTSKSATMQRIMLAGWLVEVFMAKLNSLDDNIMTQAELSDK
LTMSESRKLLESVRQEYHDFVKRHKGDLDRKLVYDVVNSHGREAEVLYFAEAIKDYNYVLSYWVQRERWTDVLKV
LQKQTDPNVFYDNSSVLMTHVPQETVEILMRHGDLEPRRLIPAMLEYNARFAGDWQGQNQAIRYLNYAVFQLNSS
DAAVHNTLVSMYAALPSRDESGLLSYLQAQGDEARYDPDFALRLCIQHHRTLSCVHIYTSMGQYLQAVDLALSHG
ETELAAVIADRPMTSPRLRKRLWLAVARKVITKSDGIKAAIDFLKRCELLKIEDLIPFFPDFVVIDDFKEEICGA
LEDYSRNIDSLKKEMDESSQTASNIRIDIGALDHRYALVEPGEKCYVCGLPLLSRQFFVFPCQHSFHSDCMGRKV
LEQSGMSKSARIKELQVQIHKGLVSGQRRETLVAELDSLVASACILCSDFAIKRIDEPFVANKDNAGDWAL*
Coding >OphauB2|2864
ATGGCCATGTCGCTCGACGCAGGCGACGGCTTTGTGGCCGCAGCAGCAGCAGCATCATCATCAGGCTTGCCAGGG
CTCGGCGATGACGGCATACCCATCTTCACTGTAGAGCGTGTGCAGCTGAAATTCTCCATTGCGGCCGAGTTTACT
GCAGCTCAAGTGGCCAACAATGTCATTGTGCTGGCTCTGTCGAATGGCCGGATCCTGCGCATCGACCTGGACCGG
CCCGAGGACATTGACGACATTGATCTGCCGAGGAAGACGACTGACGTGGGAAGGATTCGACGCATGTTTCTCGAC
CCCACGGCGTCGCATCTTCTCATTTGCACCACGTCGGGCGACAACTACTACCTACACTCGCAGTCCAAACACCCG
CGGCCCCTTGGTCGATTGCGTGGCGTGGGCATTCAGAGCGTGGCGTGGAATCCCTCGCTCCCGACTGCTTCGACG
CGTGAGATTCTGCTCGGTGCGTCGGACGGCAATATTTACGAGGTCTTTATCGAGACGTCCAACGAATTCTACAAG
AAGGAGGTGAAGCACCTCAAGAATCTGCACAAGCTTCCAGATGGCCCCATTACGGGCTTATGGGTGGACAGTCTG
GACAGCAAATCGGACCTGCGAAGGGTACTCATTGCAACGCAAAGCAGGCTCTTTCACCTTGTTGGTAGGCTTGGC
CACGCCAGTGATGGGACAGGATCCGTCTATACGAGGCTCTTTGAGTCGGAGCAGCCCGTAATTCACGACCAGGGA
CGCCCCCAGTCCAACGCTTATTCGACCATGGCGGTAACGCCAGATGCATCCGAGCCGGCGCCGTCGACTGACGAT
GGTGGGGAAAGGGCCTATGCCTGGTTATGTTGGCAAGGAATCTTGCATGGCAAACTCGCACATAGCCCAAAGGAT
AATAGCTTGGGCTCAAGAGTCTTTTCAGAGTCCAAGATGATGGCCAAGGGCCAAGTGATTAATGCGGAATCACGA
AATTCACTTTCGAGTTCAATCGAAGCAATGGCCCTCACACAGTGGCACATTATCAGTCTTGTCGGCGGTCGTGTT
GTTGCGACAAACCGTCTTACGGGTAAACTTGTATCGGAGCATGAAGTGCTCAGCCCTGGGCAGAAGTCGCTGGGG
TTTGCCGTGGACATGCAAAAAAACACATTTTGGTTCTTTACGCCTGATGAGATATACGAGATTGTGGTGCGAGAC
GAGGACCGAAGCATCTGGCGCATCATGATGGAGAGTAAGCAGTACGAGTCGGCACTGCAGCATTGTCGGACGGCA
GGCCAAAAGGAAACGGTAGCCGCTGCATACGGCGACCACTTGTCCAGCAAGGGCCACTGGACCGAGGCAGCAAGC
ATATATGGACGGAGCAACAAGCCATTTGAAGATGTCGCGCTCGACATGATTGACAACAACCAGCCCGACGCACTG
CGGCAGTTCTTGCTGACGAGGCTAGCCGTGACGAGCAAGTCGGCCACGATGCAACGCATCATGTTGGCTGGATGG
CTGGTTGAAGTCTTCATGGCCAAGCTCAACTCGCTGGACGACAACATCATGACACAGGCGGAGCTGTCGGACAAG
CTCACCATGAGCGAGTCTCGCAAACTGCTCGAGTCGGTGAGACAAGAGTACCACGACTTTGTCAAGCGGCACAAG
GGCGATTTGGACCGCAAACTCGTCTACGATGTTGTTAATAGCCACGGGCGCGAGGCCGAAGTGCTCTATTTTGCC
GAGGCCATCAAGGACTACAACTATGTCTTGTCATACTGGGTGCAGCGCGAGCGATGGACAGATGTGCTCAAGGTG
CTGCAAAAGCAGACGGACCCCAACGTCTTTTACGACAATAGCAGCGTTCTCATGACGCATGTGCCGCAAGAGACG
GTGGAGATCTTGATGAGACATGGCGACCTGGAGCCCCGTCGACTGATTCCGGCCATGCTCGAGTACAATGCCAGG
TTTGCGGGCGACTGGCAGGGGCAGAACCAGGCAATCAGATATCTCAACTATGCAGTCTTTCAGCTCAACTCGAGC
GACGCAGCAGTGCACAATACGCTCGTGTCCATGTACGCGGCGCTGCCGTCGCGAGACGAGTCTGGGCTCTTGTCA
TATCTGCAGGCGCAGGGAGACGAAGCGCGATACGACCCCGACTTTGCGCTGCGGCTGTGCATCCAGCACCACCGG
ACGCTGTCGTGTGTGCACATTTACACCAGCATGGGCCAGTACCTGCAGGCGGTGGATCTGGCCCTGTCTCATGGC
GAGACGGAGCTGGCAGCTGTCATTGCCGACCGCCCCATGACTAGCCCTCGGCTGCGCAAGCGGCTGTGGCTGGCG
GTGGCTCGCAAGGTGATTACCAAGTCGGACGGCATCAAGGCCGCCATTGACTTTCTCAAACGGTGCGAGCTGCTC
AAGATTGAGGATCTGATACCCTTCTTCCCCGACTTTGTCGTGATTGACGACTTCAAGGAGGAGATATGTGGCGCG
CTGGAAGACTACAGCCGCAACATTGACAGCCTAAAGAAGGAAATGGACGAGTCATCGCAGACGGCCAGCAACATC
CGCATCGACATTGGCGCGCTGGACCATCGGTATGCGCTGGTGGAACCGGGCGAAAAGTGCTACGTGTGCGGCCTG
CCGCTGCTGAGCCGCCAGTTTTTTGTGTTTCCCTGCCAGCACTCGTTTCACTCGGACTGCATGGGGCGCAAGGTG
CTGGAGCAGTCGGGCATGAGCAAGTCGGCGAGGATCAAGGAGCTGCAGGTGCAGATACACAAGGGGCTGGTGAGC
GGGCAGAGGAGAGAGACTCTGGTGGCTGAGCTTGACTCGCTCGTGGCGTCTGCGTGCATCCTGTGCAGCGACTTT
GCCATTAAACGCATCGACGAGCCCTTTGTGGCCAACAAGGACAATGCTGGCGACTGGGCCCTGTGA
Transcript >OphauB2|2864
ATGGCCATGTCGCTCGACGCAGGCGACGGCTTTGTGGCCGCAGCAGCAGCAGCATCATCATCAGGCTTGCCAGGG
CTCGGCGATGACGGCATACCCATCTTCACTGTAGAGCGTGTGCAGCTGAAATTCTCCATTGCGGCCGAGTTTACT
GCAGCTCAAGTGGCCAACAATGTCATTGTGCTGGCTCTGTCGAATGGCCGGATCCTGCGCATCGACCTGGACCGG
CCCGAGGACATTGACGACATTGATCTGCCGAGGAAGACGACTGACGTGGGAAGGATTCGACGCATGTTTCTCGAC
CCCACGGCGTCGCATCTTCTCATTTGCACCACGTCGGGCGACAACTACTACCTACACTCGCAGTCCAAACACCCG
CGGCCCCTTGGTCGATTGCGTGGCGTGGGCATTCAGAGCGTGGCGTGGAATCCCTCGCTCCCGACTGCTTCGACG
CGTGAGATTCTGCTCGGTGCGTCGGACGGCAATATTTACGAGGTCTTTATCGAGACGTCCAACGAATTCTACAAG
AAGGAGGTGAAGCACCTCAAGAATCTGCACAAGCTTCCAGATGGCCCCATTACGGGCTTATGGGTGGACAGTCTG
GACAGCAAATCGGACCTGCGAAGGGTACTCATTGCAACGCAAAGCAGGCTCTTTCACCTTGTTGGTAGGCTTGGC
CACGCCAGTGATGGGACAGGATCCGTCTATACGAGGCTCTTTGAGTCGGAGCAGCCCGTAATTCACGACCAGGGA
CGCCCCCAGTCCAACGCTTATTCGACCATGGCGGTAACGCCAGATGCATCCGAGCCGGCGCCGTCGACTGACGAT
GGTGGGGAAAGGGCCTATGCCTGGTTATGTTGGCAAGGAATCTTGCATGGCAAACTCGCACATAGCCCAAAGGAT
AATAGCTTGGGCTCAAGAGTCTTTTCAGAGTCCAAGATGATGGCCAAGGGCCAAGTGATTAATGCGGAATCACGA
AATTCACTTTCGAGTTCAATCGAAGCAATGGCCCTCACACAGTGGCACATTATCAGTCTTGTCGGCGGTCGTGTT
GTTGCGACAAACCGTCTTACGGGTAAACTTGTATCGGAGCATGAAGTGCTCAGCCCTGGGCAGAAGTCGCTGGGG
TTTGCCGTGGACATGCAAAAAAACACATTTTGGTTCTTTACGCCTGATGAGATATACGAGATTGTGGTGCGAGAC
GAGGACCGAAGCATCTGGCGCATCATGATGGAGAGTAAGCAGTACGAGTCGGCACTGCAGCATTGTCGGACGGCA
GGCCAAAAGGAAACGGTAGCCGCTGCATACGGCGACCACTTGTCCAGCAAGGGCCACTGGACCGAGGCAGCAAGC
ATATATGGACGGAGCAACAAGCCATTTGAAGATGTCGCGCTCGACATGATTGACAACAACCAGCCCGACGCACTG
CGGCAGTTCTTGCTGACGAGGCTAGCCGTGACGAGCAAGTCGGCCACGATGCAACGCATCATGTTGGCTGGATGG
CTGGTTGAAGTCTTCATGGCCAAGCTCAACTCGCTGGACGACAACATCATGACACAGGCGGAGCTGTCGGACAAG
CTCACCATGAGCGAGTCTCGCAAACTGCTCGAGTCGGTGAGACAAGAGTACCACGACTTTGTCAAGCGGCACAAG
GGCGATTTGGACCGCAAACTCGTCTACGATGTTGTTAATAGCCACGGGCGCGAGGCCGAAGTGCTCTATTTTGCC
GAGGCCATCAAGGACTACAACTATGTCTTGTCATACTGGGTGCAGCGCGAGCGATGGACAGATGTGCTCAAGGTG
CTGCAAAAGCAGACGGACCCCAACGTCTTTTACGACAATAGCAGCGTTCTCATGACGCATGTGCCGCAAGAGACG
GTGGAGATCTTGATGAGACATGGCGACCTGGAGCCCCGTCGACTGATTCCGGCCATGCTCGAGTACAATGCCAGG
TTTGCGGGCGACTGGCAGGGGCAGAACCAGGCAATCAGATATCTCAACTATGCAGTCTTTCAGCTCAACTCGAGC
GACGCAGCAGTGCACAATACGCTCGTGTCCATGTACGCGGCGCTGCCGTCGCGAGACGAGTCTGGGCTCTTGTCA
TATCTGCAGGCGCAGGGAGACGAAGCGCGATACGACCCCGACTTTGCGCTGCGGCTGTGCATCCAGCACCACCGG
ACGCTGTCGTGTGTGCACATTTACACCAGCATGGGCCAGTACCTGCAGGCGGTGGATCTGGCCCTGTCTCATGGC
GAGACGGAGCTGGCAGCTGTCATTGCCGACCGCCCCATGACTAGCCCTCGGCTGCGCAAGCGGCTGTGGCTGGCG
GTGGCTCGCAAGGTGATTACCAAGTCGGACGGCATCAAGGCCGCCATTGACTTTCTCAAACGGTGCGAGCTGCTC
AAGATTGAGGATCTGATACCCTTCTTCCCCGACTTTGTCGTGATTGACGACTTCAAGGAGGAGATATGTGGCGCG
CTGGAAGACTACAGCCGCAACATTGACAGCCTAAAGAAGGAAATGGACGAGTCATCGCAGACGGCCAGCAACATC
CGCATCGACATTGGCGCGCTGGACCATCGGTATGCGCTGGTGGAACCGGGCGAAAAGTGCTACGTGTGCGGCCTG
CCGCTGCTGAGCCGCCAGTTTTTTGTGTTTCCCTGCCAGCACTCGTTTCACTCGGACTGCATGGGGCGCAAGGTG
CTGGAGCAGTCGGGCATGAGCAAGTCGGCGAGGATCAAGGAGCTGCAGGTGCAGATACACAAGGGGCTGGTGAGC
GGGCAGAGGAGAGAGACTCTGGTGGCTGAGCTTGACTCGCTCGTGGCGTCTGCGTGCATCCTGTGCAGCGACTTT
GCCATTAAACGCATCGACGAGCCCTTTGTGGCCAACAAGGACAATGCTGGCGACTGGGCCCTGTGA
Gene >OphauB2|2864
ATGGCCATGTCGCTCGACGCAGGCGACGGCTTTGTGGCCGCAGCAGCAGCAGCATCATCATCAGGCTTGCCAGGG
CTCGGCGATGACGGCATACCCATCTTCACTGTAGAGCGTGTGCAGCTGAAATTCTCCATTGCGGCCGAGTTTACT
GCAGCTCAAGTGGCCAACAATGTCATTGTGCTGGCTCTGTCGAATGGCCGGATCCTGCGCATCGACCTGGACCGG
CCCGAGGACATTGACGGTAGGCAAGCTGTTGCATGCTGCGCACTGGCGCCGACTAGACTGCTGACGGCCCTGTAG
ACATTGATCTGCCGAGGAAGACGACTGACGTGGGAAGGATTCGACGCATGTTTCTCGACCCCACGGCGTCGCATC
TTCTCATTTGCACCACGTCGGGCGACAACTACTACCTACACTCGCAGTCCAAACACCCGCGGCCCCTTGGTCGAT
TGCGTGGCGTGGGCATTCAGAGCGTGGCGTGGAATCCCTCGCTCCCGACTGCTTCGACGCGTGAGATTCTGCTCG
GTGCGTCGGACGGCAATATTTACGAGGTCTTTATCGAGACGTCCAACGAATTCTACAAGAAGGAGGTGAAGCACC
TCAAGAATCTGCACAAGCTTCCAGATGGCCCCATTACGGGCTTATGGGTGGACAGTCTGGACAGCAAATCGGACC
TGCGAAGGGTACTCATTGCAACGCAAAGCAGGCTCTTTCACCTTGTTGGTAGGCTTGGCCACGCCAGTGATGGGA
CAGGATCCGTCTATACGAGGCTCTTTGAGTCGGAGCAGCCCGTAATTCACGACCAGGGACGCCCCCAGTCCAACG
CTTATTCGACCATGGCGGTAACGCCAGATGCATCCGAGCCGGCGCCGTCGACTGACGATGGTGGGGAAAGGGCCT
ATGCCTGGTTATGTTGGCAAGGAATCTTGCATGGCAAACTCGCACATAGCCCAAAGGATAATAGCTTGGGCTCAA
GAGTCTTTTCAGAGTCCAAGATGATGGCCAAGGGCCAAGTGATTAATGCGGAATCACGAAATTCACTTTCGAGTT
CAATCGAAGCAATGGCCCTCACACAGTGGCACATTATCAGTCTTGTCGGCGGTCGTGTTGTTGCGACAAACCGTC
TTACGGGTAAACTTGTATCGGAGCATGAAGTGCTCAGCCCTGGGCAGAAGTCGCTGGGGTTTGCCGTGGACATGC
AAAAAAACACATTTTGGTTCTTTACGCCTGATGAGATATACGAGATTGTGGTGCGAGACGAGGACCGAAGCATCT
GGCGCATCATGATGGAGAGTAAGCAGTACGAGTCGGCACTGCAGCATTGTCGGACGGCAGGCCAAAAGGAAACGG
TAGCCGCTGCATACGGCGACCACTTGTCCAGCAAGGGCCACTGGACCGAGGCAGCAAGCATATATGGACGGAGCA
ACAAGCCATTTGAAGATGTCGCGCTCGACATGATTGACAACAACCAGCCCGACGCACTGCGGCAGTTCTTGCTGA
CGAGGCTAGCCGTGACGAGCAAGTCGGCCACGATGCAACGCATCATGTTGGCTGGATGGCTGGTTGAAGTCTTCA
TGGCCAAGCTCAACTCGCTGGACGACAACATCATGACACAGGCGGAGCTGTCGGACAAGCTCACCATGAGCGAGT
CTCGCAAACTGCTCGAGTCGGTGAGACAAGAGTACCACGACTTTGTCAAGCGGCACAAGGGCGATTTGGACCGCA
AACTCGTCTACGATGTTGTTAATAGCCACGGGCGCGAGGCCGAAGTGCTCTATTTTGCCGAGGCCATCAAGGACT
ACAACTATGTCTTGTCATACTGGGTGCAGCGCGAGCGATGGACAGATGTGCTCAAGGTGCTGCAAAAGCAGACGG
ACCCCAACGTCTTTTACGACAATAGCAGCGTTCTCATGACGCATGTGCCGCAAGAGACGGTGGAGATCTTGATGA
GACATGGCGACCTGGAGCCCCGTCGACTGATTCCGGCCATGCTCGAGTACAATGCCAGGTTTGCGGGCGACTGGC
AGGGGCAGAACCAGGCAATCAGATATCTCAACTATGCAGTCTTTCAGCTCAACTCGAGCGACGCAGCAGTGCACA
ATACGCTCGTGTCCATGTACGCGGCGCTGCCGTCGCGAGACGAGTCTGGGCTCTTGTCATATCTGCAGGCGCAGG
GAGACGAAGCGCGATACGACCCCGACTTTGCGCTGCGGCTGTGCATCCAGCACCACCGGACGCTGTCGTGTGTGC
ACATTTACACCAGCATGGGCCAGTACCTGCAGGCGGTGGATCTGGCCCTGTCTCATGGCGAGACGGAGCTGGCAG
CTGTCATTGCCGACCGCCCCATGACTAGCCCTCGGCTGCGCAAGCGGCTGTGGCTGGCGGTGGCTCGCAAGGTGA
TTACCAAGTCGGACGGCATCAAGGCCGCCATTGACTTTCTCAAACGGTGCGAGCTGCTCAAGATTGAGGATCTGA
TACCCTTCTTCCCCGACTTTGTCGTGATTGACGACTTCAAGGAGGAGATATGTGGCGCGCTGGAAGACTACAGCC
GCAACATTGACAGCCTAAAGAAGGAAATGGACGAGTCATCGCAGACGGCCAGCAACATCCGCATCGACATTGGCG
CGCTGGACCATCGGTATGCGCTGGTGGAACCGGGCGAAAAGTGCTACGTGTGCGGCCTGCCGCTGCTGAGCCGCC
AGTTTTTTGTGTTTCCCTGCCAGCACTCGTTTCACTCGGACTGCATGGGGCGCAAGGTGCTGGAGCAGTCGGGCA
TGAGCAAGTCGGCGAGGATCAAGGAGCTGCAGGTGCAGATACACAAGGGGCTGGTGAGCGGGCAGAGGAGAGAGA
CTCTGGTGGCTGAGCTTGACTCGCTCGTGGCGTCTGCGTGGTAGAGTGCCTTTATTGCCTTTTTTTTGTTTTGTT
TGCTCTGCTGACAGTCAGACGTCTAGCATCCTGTGCAGCGACTTTGCCATTAAACGCATCGACGAGCCCTTTGTG
GCCAACAAGGACAATGCTGGCGACTGGGCCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail