Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2863
Gene name
LocationContig_196:29828..31250
Strand+
Gene length (bp)1422
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.5E-14 136 239
PF13649 Methyltransf_25 Methyltransferase domain 1.5E-10 142 230
PF13847 Methyltransf_31 Methyltransferase domain 5.1E-09 141 240
PF08242 Methyltransf_12 Methyltransferase domain 1.3E-07 143 232
PF08241 Methyltransf_11 Methyltransferase domain 1.5E-04 143 232

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 131 292 5.0E-06

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2863
MSESALTAMTSLVDTDEELDKACASQHTSGHDVVPQEEDDFPDDAVSIYAKSHYPRAPSPHGTALVYINDTKRAG
SDIAASTRSLWVPDLDYREIHGRRYCGDYYMPNDEIEQLRLSLQHQVFLHLLSGEVSCVSLDDPKFILDVGTGTG
EWPIRMAELYPDCEVVGTDISAIAETQSVPMNVFFEVEDAEEWDRPLDHYDLIHFRCMEGSFRDWRFIYDSVFDS
LKPGGWVEMIDFDSIESVKIWFTAFSEGSPIFDMAQDLEVAAEKVGRKRGITHMDPQLLKESGFTDIREVEHAIP
MKVGEKSAGKLWLISCLDALEANCLRLLTQQMDWDPEKCKIACEQAARELANLAKDPEKAKGLLVKAKTLIARKP
LDARPSMHGTRRATRSSSIEVLHDSPHTNTPSTSEVFDAFAAADGRAKSPLAQDGLQGGVYGLQGGPFRRAY*
Coding >OphauB2|2863
ATGAGTGAGAGTGCCTTGACGGCCATGACAAGCCTTGTCGATACGGACGAGGAGCTGGACAAGGCCTGTGCTTCG
CAGCATACATCTGGCCACGACGTTGTACCCCAAGAAGAAGACGACTTTCCCGACGATGCAGTTTCAATTTACGCA
AAGAGCCATTATCCTCGTGCTCCAAGTCCCCATGGCACTGCCCTGGTGTACATTAATGACACGAAGCGTGCAGGC
TCTGACATCGCAGCATCTACTCGATCATTGTGGGTGCCGGATCTTGATTATCGCGAAATTCATGGACGCCGTTAT
TGCGGTGACTATTATATGCCCAACGACGAAATAGAACAGCTCCGCCTATCTCTTCAGCACCAAGTCTTTTTGCAT
CTTCTCAGCGGCGAGGTCAGCTGTGTGTCTCTTGACGATCCCAAATTTATACTCGACGTTGGCACTGGCACGGGC
GAATGGCCCATTAGAATGGCGGAACTGTATCCGGATTGTGAAGTTGTGGGGACTGACATCTCTGCCATTGCAGAA
ACTCAGAGTGTTCCAATGAATGTCTTTTTTGAAGTGGAAGATGCTGAGGAATGGGATCGGCCTCTGGACCACTAC
GACCTCATTCACTTTCGCTGTATGGAAGGGTCGTTTCGAGATTGGCGCTTCATTTATGACAGTGTCTTTGATTCG
CTCAAGCCTGGCGGTTGGGTCGAGATGATTGACTTTGATAGCATCGAATCGGTAAAGATATGGTTTACAGCTTTT
TCGGAAGGCTCTCCCATTTTCGACATGGCTCAAGACCTTGAAGTAGCTGCGGAAAAGGTGGGACGAAAACGCGGC
ATTACGCACATGGATCCGCAACTGCTCAAAGAGTCTGGCTTCACTGATATTCGAGAGGTGGAACACGCCATTCCC
ATGAAGGTGGGCGAAAAGTCTGCAGGCAAGCTCTGGCTGATATCGTGCTTGGACGCTCTCGAGGCAAATTGCCTG
CGCCTTCTCACCCAGCAAATGGACTGGGATCCTGAAAAGTGCAAGATTGCATGCGAGCAAGCAGCTCGTGAATTG
GCCAACCTGGCCAAGGACCCCGAAAAGGCCAAGGGGCTGCTCGTCAAGGCCAAGACATTGATTGCCAGGAAGCCG
CTAGACGCACGGCCGTCGATGCATGGAACGCGACGTGCTACGAGATCATCTAGCATTGAGGTGCTTCATGACAGT
CCTCACACAAACACTCCTTCGACATCGGAGGTCTTTGATGCTTTTGCAGCTGCTGATGGCAGGGCAAAGTCTCCA
CTTGCTCAAGACGGACTCCAAGGAGGAGTATATGGATTGCAAGGAGGACCATTTAGACGGGCCTATTGA
Transcript >OphauB2|2863
ATGAGTGAGAGTGCCTTGACGGCCATGACAAGCCTTGTCGATACGGACGAGGAGCTGGACAAGGCCTGTGCTTCG
CAGCATACATCTGGCCACGACGTTGTACCCCAAGAAGAAGACGACTTTCCCGACGATGCAGTTTCAATTTACGCA
AAGAGCCATTATCCTCGTGCTCCAAGTCCCCATGGCACTGCCCTGGTGTACATTAATGACACGAAGCGTGCAGGC
TCTGACATCGCAGCATCTACTCGATCATTGTGGGTGCCGGATCTTGATTATCGCGAAATTCATGGACGCCGTTAT
TGCGGTGACTATTATATGCCCAACGACGAAATAGAACAGCTCCGCCTATCTCTTCAGCACCAAGTCTTTTTGCAT
CTTCTCAGCGGCGAGGTCAGCTGTGTGTCTCTTGACGATCCCAAATTTATACTCGACGTTGGCACTGGCACGGGC
GAATGGCCCATTAGAATGGCGGAACTGTATCCGGATTGTGAAGTTGTGGGGACTGACATCTCTGCCATTGCAGAA
ACTCAGAGTGTTCCAATGAATGTCTTTTTTGAAGTGGAAGATGCTGAGGAATGGGATCGGCCTCTGGACCACTAC
GACCTCATTCACTTTCGCTGTATGGAAGGGTCGTTTCGAGATTGGCGCTTCATTTATGACAGTGTCTTTGATTCG
CTCAAGCCTGGCGGTTGGGTCGAGATGATTGACTTTGATAGCATCGAATCGGTAAAGATATGGTTTACAGCTTTT
TCGGAAGGCTCTCCCATTTTCGACATGGCTCAAGACCTTGAAGTAGCTGCGGAAAAGGTGGGACGAAAACGCGGC
ATTACGCACATGGATCCGCAACTGCTCAAAGAGTCTGGCTTCACTGATATTCGAGAGGTGGAACACGCCATTCCC
ATGAAGGTGGGCGAAAAGTCTGCAGGCAAGCTCTGGCTGATATCGTGCTTGGACGCTCTCGAGGCAAATTGCCTG
CGCCTTCTCACCCAGCAAATGGACTGGGATCCTGAAAAGTGCAAGATTGCATGCGAGCAAGCAGCTCGTGAATTG
GCCAACCTGGCCAAGGACCCCGAAAAGGCCAAGGGGCTGCTCGTCAAGGCCAAGACATTGATTGCCAGGAAGCCG
CTAGACGCACGGCCGTCGATGCATGGAACGCGACGTGCTACGAGATCATCTAGCATTGAGGTGCTTCATGACAGT
CCTCACACAAACACTCCTTCGACATCGGAGGTCTTTGATGCTTTTGCAGCTGCTGATGGCAGGGCAAAGTCTCCA
CTTGCTCAAGACGGACTCCAAGGAGGAGTATATGGATTGCAAGGAGGACCATTTAGACGGGCCTATTGA
Gene >OphauB2|2863
ATGAGTGAGAGTGCCTTGACGGCCATGACAAGCCTTGTCGATACGGACGAGGAGCTGGACAAGGCCTGTGCTTCG
CAGCATACATCTGGCCACGACGTTGTACCCCAAGAAGAAGACGACTTTCCCGACGATGCAGTTTCAATTTACGCA
AAGAGCCATTATCCTCGTGCTCCAAGTCCCCATGGCACTGCCCTGGTGTACATTAATGACACGAAGCGTGCAGGC
TCTGACATGTAAGTCTTTTCTGCAGGCCATTATAGTGGTTGCTGTGCAGCTAACTCGCATCTCTTTCTCCTGTTG
TCGACTTGTAGCGCAGCATCTACTCGATCATTGTGGGTGCCGGATCTTGATTATCGCGAAATTCATGGACGCCGT
TATTGCGGTGACTATTATATGCCCAACGACGAAATAGAACAGCTCCGCCTATCTCTTCAGCACCAAGTCTTTTTG
CATCTTCTCAGCGGCGAGGTCAGCTGTGTGTCTCTTGACGATCCCAAATTTATACTCGACGTTGGCACTGGCACG
GGCGAATGGCCCATTAGAATGGCGGAACTGTATCCGGATTGTGAAGTTGTGGGGACTGACATCTCTGCCATTGCA
GAAACTCAGAGTGTTCCAATGAATGTCTTTTTTGAAGTGGAAGATGCTGAGGAATGGGATCGGCCTCTGGACCAC
TACGACCTCATTCACTTTCGCTGTATGGAAGGGTCGTTTCGAGATTGGCGCTTCATTTATGACAGTGTCTTTGAT
TCGCTCAAGCCTGGCGGTTGGGTCGAGATGATTGACTTTGATAGCATCGAATCGGTAAAGATATGGTTTACAGCT
TTTTCGGAAGGCTCTCCCATTTTCGACATGGCTCAAGACCTTGAAGTAGCTGCGGAAAAGGTGGGACGAAAACGC
GGCATTACGCACATGGATCCGCAACTGCTCAAAGAGTCTGGCTTCACTGATATTCGAGAGGTGGAACACGCCATT
CCCATGAAGGTGGGCGAAAAGTCTGCAGGCAAGCTCTGGCTGATATCGTGCTTGGACGCTCTCGAGGCAAATTGC
CTGCGCCTTCTCACCCAGCAAATGGACTGGGATCCTGAAAAGTGCAAGATTGCATGCGAGCAAGCAGCTCGTGAA
TTGGCCAACCTGGCCAAGGACCCCGAAAAGGCCAAGGGGCTGCTCGTCAAGGCCAAGACATTGATTGCCAGGAAG
CCGCTAGACGCACGGCCGTCGATGCATGGAACGCGACGTGCTACGAGATCATCTAGCATTGAGGTGCTTCATGAC
AGTCCTCACACAAACACTCCTTCGACATCGGAGGTCTTTGATGCTTTTGCAGCTGCTGATGGCAGGGCAAAGTCT
CCACTTGCTCAAGACGGACTCCAAGGAGGAGTATATGGATTGCAAGGAGGACCATTTAGACGGGCCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail