Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2861
Gene name
LocationContig_196:24759..26205
Strand+
Gene length (bp)1446
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.3E-70 45 354
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.2E-57 44 285
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 9.0E-21 44 308
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.3E-21 46 268
PF04321 RmlD_sub_bind RmlD substrate binding domain 9.7E-21 43 357
PF07993 NAD_binding_4 Male sterility protein 4.1E-17 46 225
PF13460 NAD_binding_10 NAD(P)H-binding 4.0E-07 88 219

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 42 406 2.0E-110
sp|Q9SYM5|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 42 378 3.0E-109
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 42 398 1.0E-108
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 37 379 2.0E-106
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 39 379 7.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 42 406 2.0E-110
sp|Q9SYM5|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 42 378 3.0E-109
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 42 398 1.0E-108
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 37 379 2.0E-106
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 39 379 7.0E-106
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 37 379 1.0E-105
sp|Q54WS6|TGDS_DICDI dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1 41 366 3.0E-96
sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 41 360 2.0E-83
sp|P37761|RMLB_NEIGO dTDP-glucose 4,6-dehydratase OS=Neisseria gonorrhoeae GN=rfbB PE=3 SV=1 40 359 2.0E-73
sp|D4GU72|AGL12_HALVD Low-salt glycan biosynthesis protein Agl12 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl12 PE=3 SV=1 43 359 1.0E-71
sp|P26391|RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbB PE=1 SV=1 44 359 1.0E-70
sp|Q9S642|RMLB_NEIMA dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rfbB1 PE=3 SV=1 41 359 1.0E-70
sp|P55294|RMLB_NEIMB dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rfbB1 PE=3 SV=2 41 370 4.0E-70
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 44 359 8.0E-70
sp|P37759|RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) GN=rfbB PE=3 SV=2 44 359 6.0E-69
sp|P27830|RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) GN=rffG PE=1 SV=3 41 370 3.0E-68
sp|P39630|RMLB_BACSU dTDP-glucose 4,6-dehydratase OS=Bacillus subtilis (strain 168) GN=rfbB PE=1 SV=1 41 359 6.0E-68
sp|P55293|RMLB1_ECOLX dTDP-glucose 4,6-dehydratase OS=Escherichia coli GN=rfbB PE=3 SV=1 44 359 1.0E-67
sp|P44914|RMLB_HAEIN dTDP-glucose 4,6-dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rffG PE=3 SV=1 43 359 2.0E-64
sp|B0RVL0|RMLB_XANCB dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rfbB PE=3 SV=1 45 359 8.0E-64
sp|P55462|RFBB_RHISN Probable dTDP-glucose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03580 PE=3 SV=1 44 367 3.0E-63
sp|Q9ZAE8|RMLB_ACTS5 dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbB PE=3 SV=2 44 367 6.0E-63
sp|P0C7J0|RMLB_XANCP dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rfbB PE=3 SV=1 45 359 1.0E-62
sp|Q9L9E8|NOVT_STRNV dTDP-glucose 4,6-dehydratase OS=Streptomyces niveus GN=novT PE=3 SV=1 44 367 4.0E-61
sp|Q6E7F4|RMLB2_ECOLX dTDP-glucose 4,6-dehydratase OS=Escherichia coli GN=rmlB PE=1 SV=1 44 367 3.0E-59
sp|P29782|RMLB_STRGR dTDP-glucose 4,6-dehydratase OS=Streptomyces griseus GN=strE PE=1 SV=1 43 367 1.0E-55
sp|Q9HDU4|YHEB_SCHPO Uncharacterized protein PB2B2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.11 PE=3 SV=1 45 359 5.0E-54
sp|A0QSK6|RMLB_MYCS2 dTDP-glucose 4,6-dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlB PE=1 SV=1 44 367 2.0E-51
sp|P95780|RMLB_STRMU dTDP-glucose 4,6-dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rmlB PE=1 SV=2 42 367 7.0E-51
sp|P9WN65|RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlB PE=1 SV=1 44 367 2.0E-48
sp|P9WN64|RMLB_MYCTO dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlB PE=3 SV=1 44 367 2.0E-48
sp|Q58455|Y1055_METJA Uncharacterized protein MJ1055 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1055 PE=3 SV=1 42 361 2.0E-26
sp|O06485|YFNG_BACSU Putative sugar dehydratase/epimerase YfnG OS=Bacillus subtilis (strain 168) GN=yfnG PE=3 SV=2 42 362 4.0E-26
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 44 361 1.0E-25
sp|A0R5C5|GALE_MYCS2 UDP-glucose 4-epimerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6142 PE=1 SV=2 45 360 1.0E-24
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 45 361 1.0E-24
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 45 361 1.0E-24
sp|O34886|YTCB_BACSU Uncharacterized UDP-glucose epimerase YtcB OS=Bacillus subtilis (strain 168) GN=ytcB PE=3 SV=1 43 295 8.0E-24
sp|P35675|YGAE_ERWAM Uncharacterized protein in galE 3'region (Fragment) OS=Erwinia amylovora PE=3 SV=1 44 198 2.0E-23
sp|O54067|LPSL_RHIME UDP-glucuronate 5'-epimerase OS=Rhizobium meliloti (strain 1021) GN=lspL PE=3 SV=2 45 361 3.0E-21
sp|P35673|GALE_ERWAM UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1 43 361 3.0E-21
sp|Q8S8T4|UXS4_ARATH UDP-glucuronic acid decarboxylase 4 OS=Arabidopsis thaliana GN=UXS4 PE=2 SV=1 41 364 9.0E-21
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 44 362 1.0E-20
sp|Q9LZI2|UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana GN=UXS2 PE=1 SV=1 38 368 7.0E-20
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 42 361 1.0E-19
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 42 361 1.0E-19
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 42 361 1.0E-19
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 42 361 1.0E-19
sp|Q04973|VIPB_SALTI Vi polysaccharide biosynthesis protein VipB/TviC OS=Salmonella typhi GN=vipB PE=3 SV=1 42 359 2.0E-19
sp|P14169|RFBE_SALTI CDP-paratose 2-epimerase OS=Salmonella typhi GN=rfbE PE=1 SV=2 44 273 2.0E-19
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 22 360 3.0E-19
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 44 366 3.0E-19
sp|Q9KDV3|GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galE PE=3 SV=1 44 268 4.0E-19
sp|Q7BJX9|GNE_PLESH UDP-N-acetylglucosamine 4-epimerase OS=Plesiomonas shigelloides GN=wbgU PE=1 SV=1 20 362 9.0E-19
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 44 358 9.0E-19
sp|Q9ZV36|UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana GN=UXS6 PE=2 SV=1 44 360 1.0E-18
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 13 360 2.0E-18
sp|Q04871|YCL2_ECO11 Uncharacterized 37.6 kDa protein in cld 5'region OS=Escherichia coli O111:H- PE=3 SV=1 45 362 2.0E-18
sp|Q59083|EXOB_AZOBR UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1 29 362 3.0E-18
sp|Q8VZC0|UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana GN=UXS1 PE=1 SV=1 44 360 6.0E-18
sp|Q331Q7|GERKI_STRSQ dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces sp. GN=gerKI PE=1 SV=1 42 360 7.0E-18
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 43 286 8.0E-18
sp|Q9FIE8|UXS3_ARATH UDP-glucuronic acid decarboxylase 3 OS=Arabidopsis thaliana GN=UXS3 PE=1 SV=1 44 360 9.0E-18
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 43 358 2.0E-17
sp|Q5SFA6|CHMD_STRBI dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces bikiniensis GN=chmD PE=1 SV=1 42 360 4.0E-17
sp|Q9W0P5|GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=Gale PE=1 SV=1 44 361 4.0E-17
sp|Q2SYH7|WBIB_BURTA dTDP-L-rhamnose 4-epimerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=wbiB PE=1 SV=1 42 361 4.0E-17
sp|Q9SN95|UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana GN=UXS5 PE=2 SV=1 44 360 5.0E-17
sp|P13226|GALE_STRLI UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2 45 359 5.0E-17
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 42 361 9.0E-17
sp|Q6T1X6|RMD_ANETH GDP-6-deoxy-D-mannose reductase OS=Aneurinibacillus thermoaerophilus GN=rmd PE=1 SV=1 45 361 1.0E-16
sp|Q9HTB6|RMD_PSEAE GDP-6-deoxy-D-mannose reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rmd PE=1 SV=1 118 356 3.0E-16
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 42 359 5.0E-16
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 41 358 9.0E-16
sp|P55353|FCL_RHISN GDP-L-fucose synthase OS=Rhizobium sp. (strain NGR234) GN=fcl PE=3 SV=1 42 359 1.0E-15
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 39 360 2.0E-15
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 32 266 3.0E-15
sp|Q8H0B2|ARAE3_ORYSJ Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1 22 360 3.0E-15
sp|Q59678|GALE_MANHA UDP-glucose 4-epimerase OS=Mannheimia haemolytica GN=galE PE=3 SV=1 44 360 4.0E-15
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 44 358 8.0E-15
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 44 358 9.0E-15
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 22 225 1.0E-14
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 44 358 1.0E-14
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 39 361 1.0E-14
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 40 302 1.0E-14
sp|Q9CNY5|GALE_PASMU UDP-glucose 4-epimerase OS=Pasteurella multocida (strain Pm70) GN=galE PE=3 SV=1 44 361 2.0E-14
sp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana GN=GAE2 PE=2 SV=1 32 359 2.0E-14
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 42 295 2.0E-14
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 42 304 3.0E-14
sp|Q8LDN8|UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 OS=Arabidopsis thaliana GN=UGE3 PE=1 SV=1 42 358 3.0E-14
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 40 360 4.0E-14
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 42 295 4.0E-14
sp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1 44 362 5.0E-14
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 44 358 7.0E-14
sp|Q56623|GALE_VIBCL UDP-glucose 4-epimerase OS=Vibrio cholerae GN=galE PE=3 SV=1 42 361 7.0E-14
sp|P24325|GALE_HAEIN UDP-glucose 4-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galE PE=3 SV=2 44 305 8.0E-14
sp|E8MF10|GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) GN=lnpD PE=1 SV=1 44 358 1.0E-13
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 41 358 1.0E-13
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 42 308 2.0E-13
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 41 358 2.0E-13
sp|Q42605|UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana GN=UGE1 PE=1 SV=2 42 358 2.0E-13
sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose synthase 1 OS=Oryza sativa subsp. japonica GN=Os06g0652400 PE=2 SV=1 139 361 3.0E-13
sp|P32055|FCL_ECOLI GDP-L-fucose synthase OS=Escherichia coli (strain K12) GN=fcl PE=1 SV=2 101 359 3.0E-13
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 41 358 4.0E-13
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 42 358 4.0E-13
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 42 361 4.0E-13
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 42 360 5.0E-13
sp|Q6E7F2|FCF1_ECOLX dTDP-4-dehydro-6-deoxyglucose reductase OS=Escherichia coli GN=fcf1 PE=1 SV=1 44 360 5.0E-13
sp|O65780|GALE1_CYATE UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1 42 358 8.0E-13
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 44 343 1.0E-12
sp|Q9M0B6|GAE1_ARATH UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana GN=GAE1 PE=1 SV=1 38 362 1.0E-12
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 41 295 1.0E-12
sp|Q7WTB1|GALE_LACHE UDP-glucose 4-epimerase OS=Lactobacillus helveticus GN=galE PE=2 SV=1 44 361 2.0E-12
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 42 360 3.0E-12
sp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana GN=GAE3 PE=2 SV=1 32 359 4.0E-12
sp|Q93VR3|GME_ARATH GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana GN=At5g28840 PE=1 SV=1 44 361 6.0E-12
sp|P33119|GALE_CORDI UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=galE PE=3 SV=2 44 286 8.0E-12
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 43 358 1.0E-11
sp|P55354|GM4D_RHISN GDP-mannose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=gmd PE=3 SV=1 95 324 1.0E-11
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 44 266 1.0E-11
sp|Q56598|GM4D_VIBCL GDP-mannose 4,6-dehydratase OS=Vibrio cholerae GN=gmd PE=3 SV=2 42 232 1.0E-11
sp|Q652A8|UGE3_ORYSJ UDP-glucose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UGE-3 PE=2 SV=1 36 361 2.0E-11
sp|O49213|FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana GN=GER1 PE=1 SV=3 101 359 2.0E-11
sp|A2Z7B3|GME1_ORYSI GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. indica GN=OsI_032456 PE=2 SV=1 44 361 3.0E-11
sp|P96995|GALE_STRMU UDP-glucose 4-epimerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galE PE=3 SV=2 44 312 3.0E-11
sp|O85713|GM4D_RHIFH GDP-mannose 4,6-dehydratase OS=Rhizobium fredii (strain HH103) GN=gmd PE=3 SV=1 95 324 3.0E-11
sp|A3C4S4|GME1_ORYSJ GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. japonica GN=GME-1 PE=1 SV=1 44 361 4.0E-11
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 44 358 4.0E-11
sp|Q2R1V8|GME2_ORYSJ GDP-mannose 3,5-epimerase 2 OS=Oryza sativa subsp. japonica GN=GME-2 PE=2 SV=2 44 361 5.0E-11
sp|Q9LMU0|FCL2_ARATH Putative GDP-L-fucose synthase 2 OS=Arabidopsis thaliana GN=GER2 PE=1 SV=1 101 361 5.0E-11
sp|P39853|CAPD_STAAU Capsular polysaccharide biosynthesis protein CapD OS=Staphylococcus aureus GN=capD PE=3 SV=1 21 249 6.0E-11
sp|Q67WR5|FCL2_ORYSJ Putative GDP-L-fucose synthase 2 OS=Oryza sativa subsp. japonica GN=Os06g0652300 PE=3 SV=1 150 359 9.0E-11
sp|Q45291|GALE_CORGL UDP-glucose 4-epimerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=galE PE=3 SV=2 44 299 1.0E-10
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana GN=GAE6 PE=1 SV=1 38 359 1.0E-10
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 41 268 3.0E-10
sp|Q1ZXF7|GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum GN=gmd PE=1 SV=1 42 356 7.0E-10
sp|Q06952|GM4D_VIBCH GDP-mannose 4,6-dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmd PE=3 SV=1 94 232 1.0E-09
sp|P26397|RFBG_SALTY CDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbG PE=1 SV=1 42 362 1.0E-09
sp|P71052|EPSC_BACSU Probable polysaccharide biosynthesis protein EpsC OS=Bacillus subtilis (strain 168) GN=epsC PE=3 SV=1 21 324 2.0E-09
sp|A8Y0L5|GMD1_CAEBR GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis briggsae GN=bre-1 PE=3 SV=2 42 232 2.0E-09
sp|P45602|GALE_KLEPN UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1 44 173 2.0E-09
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 44 362 3.0E-09
sp|Q9JRN7|TLD_AGGAC GDP-6-deoxy-D-talose 4-dehydrogenase OS=Aggregatibacter actinomycetemcomitans GN=tld PE=1 SV=1 44 267 3.0E-09
sp|Q56872|GM4D_YERE8 GDP-mannose 4,6-dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gmd PE=3 SV=2 41 232 4.0E-09
sp|O45583|GMD2_CAEEL GDP-mannose 4,6 dehydratase 2 OS=Caenorhabditis elegans GN=gmd-2 PE=1 SV=1 42 232 7.0E-09
sp|P0AC91|GM4D_SHIFL GDP-mannose 4,6-dehydratase OS=Shigella flexneri GN=gmd PE=3 SV=1 94 338 8.0E-09
sp|P0AC88|GM4D_ECOLI GDP-mannose 4,6-dehydratase OS=Escherichia coli (strain K12) GN=gmd PE=1 SV=1 94 338 8.0E-09
sp|P0AC89|GM4D_ECOL6 GDP-mannose 4,6-dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gmd PE=3 SV=1 94 338 8.0E-09
sp|P0AC90|GM4D_ECO57 GDP-mannose 4,6-dehydratase OS=Escherichia coli O157:H7 GN=gmd PE=3 SV=1 94 338 8.0E-09
sp|Q5RBE5|FCL_PONAB GDP-L-fucose synthase OS=Pongo abelii GN=TSTA3 PE=2 SV=1 100 359 1.0E-08
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 44 268 1.0E-08
sp|P47364|GALE_MYCGE UDP-glucose 4-epimerase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=galE PE=3 SV=1 44 295 2.0E-08
sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens GN=TSTA3 PE=1 SV=1 100 359 2.0E-08
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 44 283 3.0E-08
sp|O60547|GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens GN=GMDS PE=1 SV=1 94 232 4.0E-08
sp|Q8K0C9|GMDS_MOUSE GDP-mannose 4,6 dehydratase OS=Mus musculus GN=Gmds PE=1 SV=1 94 232 4.0E-08
sp|Q8K3X3|GMDS_CRIGR GDP-mannose 4,6 dehydratase OS=Cricetulus griseus GN=GMDS PE=2 SV=1 94 232 5.0E-08
sp|Q58461|Y1061_METJA Uncharacterized membrane protein MJ1061 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1061 PE=3 SV=1 42 282 5.0E-08
sp|Q9VMW9|GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster GN=Gmd PE=1 SV=2 42 232 6.0E-08
sp|Q18801|GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans GN=bre-1 PE=1 SV=3 42 232 1.0E-07
sp|Q72ET7|HLDD_DESVH ADP-L-glycero-D-manno-heptose-6-epimerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hldD PE=3 SV=1 45 304 1.0E-07
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 42 361 1.0E-07
sp|A1VGB0|HLDD_DESVV ADP-L-glycero-D-manno-heptose-6-epimerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hldD PE=3 SV=1 45 304 1.0E-07
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 40 362 2.0E-07
sp|P44094|Y1014_HAEIN Uncharacterized protein HI_1014 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1014 PE=3 SV=1 44 252 4.0E-07
sp|Q8K3X2|FCL_CRIGR GDP-L-fucose synthase OS=Cricetulus griseus GN=TSTA3 PE=2 SV=1 100 359 5.0E-07
sp|P56600|GAL10_CANMA Bifunctional protein GAL10 (Fragment) OS=Candida maltosa GN=GAL10 PE=3 SV=1 45 182 1.0E-06
sp|P18645|GALE_RAT UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1 42 361 1.0E-06
sp|Q5R8D0|GALE_PONAB UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1 42 361 2.0E-06
sp|Q0P9D4|PGLF_CAMJE UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglF PE=1 SV=1 42 300 2.0E-06
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 41 361 4.0E-06
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7 OS=Mus musculus GN=Hsd3b7 PE=1 SV=1 45 225 4.0E-06
sp|Q55C77|FCL_DICDI GDP-L-fucose synthase OS=Dictyostelium discoideum GN=ger PE=3 SV=1 42 359 4.0E-06
sp|P23591|FCL_MOUSE GDP-L-fucose synthase OS=Mus musculus GN=Tsta3 PE=1 SV=3 100 359 5.0E-06
sp|P75821|YBJS_ECOLI Uncharacterized protein YbjS OS=Escherichia coli (strain K12) GN=ybjS PE=3 SV=2 89 364 6.0E-06
sp|P21097|3BHS_VACCC 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Copenhagen) GN=A44L PE=3 SV=1 46 266 6.0E-06
sp|Q14376|GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 42 361 7.0E-06
sp|D4GS48|G6PD_HALVD NAD-dependent glucose-6-phosphate dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=azf PE=1 SV=1 44 227 8.0E-06
sp|O57245|3BHS_VACCA 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Ankara) GN=MVA157L PE=3 SV=1 46 266 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008610 lipid biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008150 biological_process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016229 steroid dehydrogenase activity No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008202 steroid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2861
MINLTHDTANGRSSVYSQDLDIWKRAPILTGTTRFEPRPGVKNIMITGGAGFIASWVVRHLTLTYPHAYNIVSFD
KLDYCSALNNTRVLNDKRNFTFYHGDLTNPSEVLDCMERHRIDTVMHFAAQSHVDLSFGNSYSFTHANVYGTHVL
LESAKKVGVKRFIHVSTDEVYGEVREDDDELLESSILAPTNPYAASKAAAEMLVQSYHKSFKLPTIIVRSNNVYG
PHQYPEKIIAKFACLLQRGRPVALHGDGSPTRRYLYAGDAADAFDTILHLGQVEQIYNVGSLDEVSNLELSRKIL
NAMDIDAENPQRFRKWIKYTKDRPFNDRRYAVDGSKLRKLGWKQNTSFDQGLKTTVEWYRQFGEAWWGDISHVLT
PFPVVSAGEVMPDDDNSMKDEPSPSRDEEQTNRDELPRR*
Coding >OphauB2|2861
ATGATCAATTTGACCCACGACACAGCCAATGGCCGCTCCAGTGTTTACTCGCAAGATCTTGACATATGGAAGCGA
GCCCCAATTCTCACAGGCACCACTCGGTTTGAGCCTCGGCCTGGTGTCAAGAATATCATGATCACAGGCGGCGCT
GGATTCATTGCGTCTTGGGTGGTTCGCCACCTCACCCTGACTTATCCCCACGCCTATAATATCGTCTCTTTCGAC
AAGCTTGACTATTGTTCAGCACTCAACAACACTAGAGTGCTCAACGATAAGCGCAACTTTACCTTTTATCATGGC
GACTTGACCAACCCGTCCGAGGTGCTTGACTGCATGGAGCGCCATCGAATCGATACCGTCATGCATTTTGCTGCA
CAATCACATGTGGATCTAAGCTTTGGCAACTCTTATAGCTTCACACACGCAAACGTTTACGGCACTCACGTACTG
TTGGAGAGCGCCAAGAAGGTTGGTGTCAAGCGCTTCATTCACGTCTCGACCGATGAGGTGTATGGTGAGGTTAGA
GAGGATGATGATGAGTTGCTTGAATCCAGCATTCTTGCCCCGACGAATCCATATGCCGCAAGTAAGGCAGCAGCC
GAGATGCTCGTACAGTCGTACCACAAGAGCTTCAAGCTTCCCACTATTATTGTCCGGAGCAACAATGTCTACGGA
CCACACCAGTATCCTGAGAAAATAATTGCAAAATTTGCCTGCCTTCTTCAGCGAGGTCGGCCTGTCGCGCTTCAC
GGCGACGGTAGCCCCACACGACGATATTTATATGCCGGTGATGCGGCGGATGCGTTTGATACAATTCTTCACCTG
GGACAGGTGGAACAGATCTACAATGTTGGCTCCCTGGACGAGGTGTCCAACCTTGAGCTCAGCCGCAAGATTCTC
AATGCCATGGACATTGATGCGGAAAACCCACAACGTTTCCGCAAGTGGATCAAGTACACCAAAGACAGACCTTTC
AATGATCGCCGGTACGCTGTTGACGGTTCAAAGCTACGCAAACTTGGATGGAAACAGAATACCAGCTTTGACCAG
GGTCTTAAGACTACAGTTGAGTGGTACCGTCAATTTGGAGAAGCGTGGTGGGGAGACATTAGCCATGTCTTGACC
CCGTTTCCAGTCGTCAGTGCAGGGGAAGTGATGCCTGATGACGATAATTCAATGAAGGACGAGCCATCACCATCT
AGAGATGAGGAGCAGACTAATAGAGACGAGTTGCCTCGTCGCTAG
Transcript >OphauB2|2861
ATGATCAATTTGACCCACGACACAGCCAATGGCCGCTCCAGTGTTTACTCGCAAGATCTTGACATATGGAAGCGA
GCCCCAATTCTCACAGGCACCACTCGGTTTGAGCCTCGGCCTGGTGTCAAGAATATCATGATCACAGGCGGCGCT
GGATTCATTGCGTCTTGGGTGGTTCGCCACCTCACCCTGACTTATCCCCACGCCTATAATATCGTCTCTTTCGAC
AAGCTTGACTATTGTTCAGCACTCAACAACACTAGAGTGCTCAACGATAAGCGCAACTTTACCTTTTATCATGGC
GACTTGACCAACCCGTCCGAGGTGCTTGACTGCATGGAGCGCCATCGAATCGATACCGTCATGCATTTTGCTGCA
CAATCACATGTGGATCTAAGCTTTGGCAACTCTTATAGCTTCACACACGCAAACGTTTACGGCACTCACGTACTG
TTGGAGAGCGCCAAGAAGGTTGGTGTCAAGCGCTTCATTCACGTCTCGACCGATGAGGTGTATGGTGAGGTTAGA
GAGGATGATGATGAGTTGCTTGAATCCAGCATTCTTGCCCCGACGAATCCATATGCCGCAAGTAAGGCAGCAGCC
GAGATGCTCGTACAGTCGTACCACAAGAGCTTCAAGCTTCCCACTATTATTGTCCGGAGCAACAATGTCTACGGA
CCACACCAGTATCCTGAGAAAATAATTGCAAAATTTGCCTGCCTTCTTCAGCGAGGTCGGCCTGTCGCGCTTCAC
GGCGACGGTAGCCCCACACGACGATATTTATATGCCGGTGATGCGGCGGATGCGTTTGATACAATTCTTCACCTG
GGACAGGTGGAACAGATCTACAATGTTGGCTCCCTGGACGAGGTGTCCAACCTTGAGCTCAGCCGCAAGATTCTC
AATGCCATGGACATTGATGCGGAAAACCCACAACGTTTCCGCAAGTGGATCAAGTACACCAAAGACAGACCTTTC
AATGATCGCCGGTACGCTGTTGACGGTTCAAAGCTACGCAAACTTGGATGGAAACAGAATACCAGCTTTGACCAG
GGTCTTAAGACTACAGTTGAGTGGTACCGTCAATTTGGAGAAGCGTGGTGGGGAGACATTAGCCATGTCTTGACC
CCGTTTCCAGTCGTCAGTGCAGGGGAAGTGATGCCTGATGACGATAATTCAATGAAGGACGAGCCATCACCATCT
AGAGATGAGGAGCAGACTAATAGAGACGAGTTGCCTCGTCGCTAG
Gene >OphauB2|2861
ATGATCAATTTGACCCACGGTAAGCGCCGCTTGGACCCCCCTTGTATTCAGCTTGGCGACGCTCATTCTAGAACA
ATTAGACACAGCCAATGGCCGCTCCAGTGTTTACTCGCAAGATCTTGACATATGGAAGCGAGCCCCAATTCTCAC
AGGCACCACTCGGTTTGAGCCTCGGCCTGGTGTCAAGAATATCATGATCACAGGCGGCGCTGGATTCATGTGAGT
CGTCCCCGCGCCCTGCTTGTCCAAGGCGACATTGGTATGGGTCCAGCTGCAGAATGCTTACCCGCAGACGCCCTG
CAGTGCGTCTTGGGTGGTTCGCCACCTCACCCTGACTTATCCCCACGCCTATAATATCGTCTCTTTCGACAAGCT
TGACTATTGTTCAGCACTCAACAACACTAGAGTGCTCAACGATAAGCGCAACTTTACCTTTTATCATGGCGACTT
GACCAACCCGTCCGAGGTGCTTGACTGCATGGAGCGCCATCGAATCGATACCGTCATGCATTTTGCTGCACAATC
ACATGTGGATCTAAGCTTTGGCAACTCTTATAGCTTCACACACGCAAACGTTTACGGCACTCACGTACTGTTGGA
GAGCGCCAAGAAGGTTGGTGTCAAGCGCTTCATTCACGTCTCGACCGATGAGGTGTATGGTGAGGTTAGAGAGGA
TGATGATGAGTTGCTTGAATCCAGCATTCTTGCCCCGACGAATCCATATGCCGCAAGTAAGGCAGCAGCCGAGAT
GCTCGTACAGTCGTACCACAAGAGCTTCAAGCTTCCCACTATTATTGTCCGGAGCAACAATGTCTACGGACCACA
CCAGTATCCTGAGAGTAGGCATTGACTTGCACTGGCTTTCGGGTAGGGTATATGCTAACAAGCATGACAGAAATA
ATTGCAAAATTTGCCTGCCTTCTTCAGCGAGGTCGGCCTGTCGCGCTTCACGGCGACGGTAGCCCCACACGACGA
TATTTATATGCCGGTGATGCGGCGGATGCGTTTGATACAATTCTTCACCTGGGACAGGTGGAACAGATCTACAAT
GTTGGCTCCCTGGACGAGGTGTCCAACCTTGAGCTCAGCCGCAAGATTCTCAATGCCATGGACATTGATGCGGAA
AACCCACAACGTTTCCGCAAGTGGATCAAGTACACCAAAGACAGACCTTTCAATGATCGCCGGTACGCTGTTGAC
GGTTCAAAGCTACGCAAACTTGGATGGAAACAGAATACCAGCTTTGACCAGGGTCTTAAGACTACAGTTGAGTGG
TACCGTCAATTTGGAGAAGCGTGGTGGGGAGACATTAGCCATGTCTTGACCCCGTTTCCAGTCGTCAGTGCAGGG
GAAGTGATGCCTGATGACGATAATTCAATGAAGGACGAGCCATCACCATCTAGAGATGAGGAGCAGACTAATAGA
GACGAGTTGCCTCGTCGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail