Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2860
Gene name
LocationContig_196:22176..23422
Strand-
Gene length (bp)1246
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 48 354 2.0E-42
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 71 364 5.0E-41
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 66 354 6.0E-39
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 71 354 4.0E-37
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 90 354 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 48 354 2.0E-42
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 71 364 5.0E-41
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 66 354 6.0E-39
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 71 354 4.0E-37
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 90 354 8.0E-26
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 51 354 8.0E-24
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 75 355 2.0E-15
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 75 356 1.0E-11
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 75 356 1.0E-10
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 74 354 1.0E-06
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 74 354 2.0E-06
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 67 353 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 67 86 19
2 96 114 18
3 127 149 22
4 154 176 22
5 183 201 18
6 216 238 22
7 250 268 18
8 283 305 22
9 310 329 19
10 339 358 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2860
MSIHYHHPPESIELTQQSPFSNTTSSCHQSQYTTLDEAEAAVGSGLLLATEASDSTTSPSCMTTTAWVTVNTLAT
IGIVFTNKAIFSDPAWKLCQLTFASFHFAVTWLTLYILSRPQLGYLSPRRAPILHLLPLAVAMCLNVVLPNLSLA
YSSVTFYQIARILLTPTVALLNLLLYGATLPRLAIVALIPVCLGVAMVSYYDSLPSAGTSNRATSPLGIVFAFVG
IAASSFYTVWIASYHKKFQMSSMQLLYSQAPVAGIILLYAIPFLDTFPEWRLVSGTRWAMIALSGVFASLINISQ
FFIVAHTGPVSSTVVGHVKTCTIVAIGWVMSGRSMSDRAVIGILVAISGIIAYSIVMLEHNARR*
Coding >OphauB2|2860
ATGAGCATTCATTATCATCATCCGCCAGAAAGTATCGAATTGACCCAGCAGAGCCCCTTCTCCAACACAACCTCG
AGCTGCCACCAGAGCCAGTACACCACCCTCGATGAAGCCGAGGCGGCTGTCGGAAGCGGATTGCTTCTGGCAACA
GAAGCTTCCGACTCGACGACTTCTCCTTCATGCATGACCACCACGGCTTGGGTGACTGTCAATACCCTGGCCACC
ATTGGCATCGTCTTTACCAACAAGGCCATCTTCTCTGACCCGGCATGGAAACTCTGCCAGCTCACCTTCGCCTCG
TTTCACTTCGCTGTGACATGGCTGACGCTCTATATCCTCTCGAGGCCGCAGCTTGGCTACCTAAGCCCTCGTCGG
GCACCCATTTTGCATCTGCTTCCCTTGGCAGTTGCAATGTGCCTCAACGTGGTTTTACCCAATCTCTCGCTGGCA
TACTCTTCTGTTACCTTCTATCAGATTGCCCGCATTCTTCTCACGCCTACTGTTGCCCTTCTCAACTTGCTTCTC
TACGGTGCCACTTTACCCAGGCTTGCCATAGTCGCCCTGATTCCCGTTTGCCTCGGAGTCGCCATGGTTTCCTAC
TATGACTCTCTCCCATCAGCAGGAACGAGCAACCGAGCAACGTCACCACTGGGCATCGTCTTTGCCTTTGTTGGT
ATCGCTGCATCGTCCTTCTACACGGTGTGGATTGCGAGCTATCACAAGAAGTTTCAAATGAGCAGCATGCAACTG
CTATACAGCCAGGCTCCGGTTGCCGGCATTATCCTCCTCTATGCCATCCCTTTTCTGGATACCTTCCCAGAATGG
AGACTTGTTTCTGGCACCCGATGGGCCATGATTGCCTTGTCGGGCGTTTTTGCGTCGCTCATTAATATTTCGCAA
TTTTTCATTGTCGCTCATACGGGTCCTGTGTCGAGCACGGTTGTCGGCCACGTAAAGACTTGTACCATTGTGGCC
ATTGGTTGGGTCATGTCAGGCCGGTCCATGAGTGATAGGGCCGTCATTGGAATCTTGGTTGCCATTAGTGGGATT
ATTGCGTATTCAATTGTCATGCTGGAGCACAATGCTCGCAGGTGA
Transcript >OphauB2|2860
ATGAGCATTCATTATCATCATCCGCCAGAAAGTATCGAATTGACCCAGCAGAGCCCCTTCTCCAACACAACCTCG
AGCTGCCACCAGAGCCAGTACACCACCCTCGATGAAGCCGAGGCGGCTGTCGGAAGCGGATTGCTTCTGGCAACA
GAAGCTTCCGACTCGACGACTTCTCCTTCATGCATGACCACCACGGCTTGGGTGACTGTCAATACCCTGGCCACC
ATTGGCATCGTCTTTACCAACAAGGCCATCTTCTCTGACCCGGCATGGAAACTCTGCCAGCTCACCTTCGCCTCG
TTTCACTTCGCTGTGACATGGCTGACGCTCTATATCCTCTCGAGGCCGCAGCTTGGCTACCTAAGCCCTCGTCGG
GCACCCATTTTGCATCTGCTTCCCTTGGCAGTTGCAATGTGCCTCAACGTGGTTTTACCCAATCTCTCGCTGGCA
TACTCTTCTGTTACCTTCTATCAGATTGCCCGCATTCTTCTCACGCCTACTGTTGCCCTTCTCAACTTGCTTCTC
TACGGTGCCACTTTACCCAGGCTTGCCATAGTCGCCCTGATTCCCGTTTGCCTCGGAGTCGCCATGGTTTCCTAC
TATGACTCTCTCCCATCAGCAGGAACGAGCAACCGAGCAACGTCACCACTGGGCATCGTCTTTGCCTTTGTTGGT
ATCGCTGCATCGTCCTTCTACACGGTGTGGATTGCGAGCTATCACAAGAAGTTTCAAATGAGCAGCATGCAACTG
CTATACAGCCAGGCTCCGGTTGCCGGCATTATCCTCCTCTATGCCATCCCTTTTCTGGATACCTTCCCAGAATGG
AGACTTGTTTCTGGCACCCGATGGGCCATGATTGCCTTGTCGGGCGTTTTTGCGTCGCTCATTAATATTTCGCAA
TTTTTCATTGTCGCTCATACGGGTCCTGTGTCGAGCACGGTTGTCGGCCACGTAAAGACTTGTACCATTGTGGCC
ATTGGTTGGGTCATGTCAGGCCGGTCCATGAGTGATAGGGCCGTCATTGGAATCTTGGTTGCCATTAGTGGGATT
ATTGCGTATTCAATTGTCATGCTGGAGCACAATGCTCGCAGGTGA
Gene >OphauB2|2860
ATGAGCATTCATTATCATCATCCGCCAGAAAGTATCGAATTGACCCAGCAGAGCCCCTTCTCCAACACAACCTCG
AGCTGCCACCAGAGCCAGTACACCACCCTCGATGAAGCCGAGGCGGCTGTCGGAAGCGGATTGCTTCTGGCAACA
GAAGCTTCCGACTCGACGACTTCTCCTTCATGCATGACCACCACGGCTTGGGTGACTGTCAATACCCTGGCCACC
ATTGGCATCGTATGTGCCAGCTGCTCTTGTTCTTGATGCCGCTGCTGCTGACCAGCTTATAGGTCTTTACCAACA
AGGCCATCTTCTCTGACCCGGCATGGAAACTCTGCCAGCTCACCTTCGCCTCGTTTCACTTCGCTGTGACATGGC
TGACGCTCTATATCCTCTCGAGGCCGCAGCTTGGCTACCTAAGCCCTCGTCGGGCACCCATTTTGCATCTGCTTC
CCTTGGCAGTTGCAATGTGCCTCAACGTGGTTTTACCCAATCTCTCGCTGGCATACTCTTCTGTTACCTTCTATC
AGATTGCCCGCATTCTTCTCACGCCTACTGTTGCCCTTCTCAACTTGCTTCTCTACGGTGCCACTTTACCCAGGC
TTGCCATAGTCGCCCTGATTCCCGTTTGCCTCGGAGTCGCCATGGTTTCCTACTATGACTCTCTCCCATCAGCAG
GAACGAGCAACCGAGCAACGTCACCACTGGGCATCGTCTTTGCCTTTGTTGGTATCGCTGCATCGTCCTTCTACA
CGGTGTGGATTGCGAGCTATCACAAGAAGTTTCAAATGAGCAGCATGCAACTGCTATACAGCCAGGCTCCGGTTG
CCGGCATTATCCTCCTCTATGCCATCCCTTTTCTGGATACCTTCCCAGAATGGAGACTTGTTTCTGGCACCCGAT
GGGCCATGATTGCCTTGGTATGCTATTCCTCTCCACGCATGCTTCTAGCTAACAAGATTAGTCGGGCGTTTTTGC
GTCGCTCATTAATATTTCGCAATTTTTCATTGTCGCTCATACGGGTCCTGTGTCGAGCACGGTTGTCGGCCACGT
AAAGACTTGTACCATTGTGGCCATTGGTTGGGTCATGTCAGGCCGGTCCATGAGTGATAGGGCCGTCATTGGAAT
CTTGGTTGCCATTAGTGGGATTATTGCGTAAGTTTTTGGGTGGTGGTGGTGGCCATACGACTTTTCGCTTACGCA
TGACAGGTATTCAATTGTCATGCTGGAGCACAATGCTCGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail