Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2859
Gene name
LocationContig_196:20762..22001
Strand+
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 7.6E-26 198 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38805|RPF1_YEAST Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1 173 412 3.0E-69
sp|O14180|YDS4_SCHPO Brix domain-containing protein C4F8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.04 PE=3 SV=1 167 412 7.0E-52
sp|Q8AVP1|RPF1_XENLA Ribosome production factor 1 OS=Xenopus laevis GN=rpf1 PE=2 SV=1 138 412 4.0E-44
sp|Q5R631|RPF1_PONAB Ribosome production factor 1 OS=Pongo abelii GN=RPF1 PE=2 SV=1 140 412 3.0E-43
sp|Q9H9Y2|RPF1_HUMAN Ribosome production factor 1 OS=Homo sapiens GN=RPF1 PE=1 SV=2 140 412 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38805|RPF1_YEAST Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1 173 412 3.0E-69
sp|O14180|YDS4_SCHPO Brix domain-containing protein C4F8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.04 PE=3 SV=1 167 412 7.0E-52
sp|Q8AVP1|RPF1_XENLA Ribosome production factor 1 OS=Xenopus laevis GN=rpf1 PE=2 SV=1 138 412 4.0E-44
sp|Q5R631|RPF1_PONAB Ribosome production factor 1 OS=Pongo abelii GN=RPF1 PE=2 SV=1 140 412 3.0E-43
sp|Q9H9Y2|RPF1_HUMAN Ribosome production factor 1 OS=Homo sapiens GN=RPF1 PE=1 SV=2 140 412 4.0E-43
sp|Q7TND5|RPF1_MOUSE Ribosome production factor 1 OS=Mus musculus GN=Rpf1 PE=2 SV=2 140 412 4.0E-42
sp|Q6IQU6|RPF1_DANRE Ribosome production factor 1 OS=Danio rerio GN=rpf1 PE=2 SV=1 138 412 6.0E-41
sp|Q5RJS9|RPF1_RAT Ribosome production factor 1 OS=Rattus norvegicus GN=Rpf1 PE=2 SV=2 140 403 1.0E-40
sp|Q9VKB4|RPF1_DROME Probable ribosome production factor 1 OS=Drosophila melanogaster GN=CG6712 PE=2 SV=1 179 383 6.0E-38
sp|P54073|YUY1_CAEEL Brix domain-containing protein F44G4.1 OS=Caenorhabditis elegans GN=F44G4.1 PE=3 SV=4 181 412 6.0E-37
sp|Q6C804|IMP4_YARLI U3 small nucleolar ribonucleoprotein protein IMP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IMP4 PE=3 SV=1 178 409 1.0E-22
sp|Q755T8|IMP4_ASHGO U3 small nucleolar ribonucleoprotein protein IMP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IMP4 PE=3 SV=2 178 400 2.0E-22
sp|O62518|YHPK_CAEEL Brix domain-containing protein ZK795.3 OS=Caenorhabditis elegans GN=ZK795.3 PE=3 SV=1 179 409 7.0E-22
sp|Q0VD01|IMP4_BOVIN U3 small nucleolar ribonucleoprotein protein IMP4 OS=Bos taurus GN=IMP4 PE=2 SV=1 179 412 3.0E-20
sp|Q6BYD9|IMP4_DEBHA U3 small nucleolar ribonucleoprotein protein IMP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IMP4 PE=3 SV=2 178 402 4.0E-20
sp|Q5PQR5|IMP4_RAT U3 small nucleolar ribonucleoprotein protein IMP4 OS=Rattus norvegicus GN=Imp4 PE=2 SV=1 179 412 4.0E-20
sp|Q5R947|IMP4_PONAB U3 small nucleolar ribonucleoprotein protein IMP4 OS=Pongo abelii GN=IMP4 PE=2 SV=2 179 412 4.0E-20
sp|Q8VHZ7|IMP4_MOUSE U3 small nucleolar ribonucleoprotein protein IMP4 OS=Mus musculus GN=Imp4 PE=2 SV=1 179 412 4.0E-20
sp|Q96G21|IMP4_HUMAN U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens GN=IMP4 PE=1 SV=1 179 412 5.0E-20
sp|P53941|IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP4 PE=1 SV=1 179 400 8.0E-20
sp|Q6FNN7|IMP4_CANGA U3 small nucleolar ribonucleoprotein protein IMP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IMP4 PE=3 SV=1 100 400 3.0E-19
sp|O13823|IMP4_SCHPO U3 small nucleolar ribonucleoprotein protein imp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp4 PE=3 SV=1 179 409 5.0E-19
sp|P38805|RPF1_YEAST Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1 11 78 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019843 rRNA binding Yes
GO:0006364 rRNA processing Yes
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003723 RNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:1901363 heterocyclic compound binding No
GO:0016072 rRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2859
MGFDKPSAQALQAANKMKRKELFVRHKKATGKERREERLRRRKEEQRDPALKAVRLAKNKTVTLDQKRVWDEGDD
DSLGARVDLEKLQRQRLEQAEAEEQEALDAGSKHGDKDDNDSMLGSDDENDDMLQACRDEHGQQQRIQRGGSIAP
STASTNLDLAPSSLALKFPSLFSDIPPADSKILVTTSLNATIHDQAQLISTLFPNSTYVPRSGHRYAYRYSLREI
CKFATKRDYTAVILIKEDLKKPTGLSIVHLPSGPTCHFSITNYLEGKKLPGHGNPTSHYPELLLNNFKTPLGLLT
AKLFQSLFPPKPEIQGRQVVTMHNQRDYIFVRRHRYVFRDRRSTEKRIVDSEGREMKGVENIRVGLQELGPQFTL
KLRRVDKGIGRAGSEGQDATQWEWKAKMEKDRKRFNL*
Coding >OphauB2|2859
ATGGGTTTCGACAAACCATCAGCACAGGCGCTTCAGGCGGCCAACAAGATGAAGCGAAAGGAACTTTTTGTCCGG
CACAAAAAAGCTACGGGCAAGGAGCGTCGAGAGGAGCGGCTCCGGCGACGCAAGGAGGAACAGCGCGACCCTGCG
CTCAAGGCGGTCAGATTAGCCAAAAATAAAACGGTGACGCTTGACCAGAAGCGAGTATGGGATGAAGGCGACGAC
GACAGCCTGGGCGCCAGAGTTGATTTGGAGAAGCTGCAGCGGCAGCGCTTGGAACAGGCCGAGGCCGAGGAGCAG
GAGGCTCTCGATGCGGGGAGCAAGCACGGGGACAAGGATGACAATGACAGCATGTTGGGCTCGGATGACGAGAAT
GACGACATGTTGCAAGCTTGTAGAGATGAGCATGGACAACAGCAACGCATTCAGAGAGGTGGCAGTATCGCCCCC
TCAACGGCAAGCACCAACCTCGATCTTGCGCCTTCGTCGCTTGCCCTCAAGTTCCCCTCGCTCTTCTCCGACATA
CCGCCAGCCGACTCCAAAATTCTCGTCACTACATCGCTAAACGCCACCATTCACGACCAGGCGCAGCTCATATCG
ACCCTCTTTCCCAACAGCACATATGTTCCCCGCTCTGGACACCGTTACGCCTACCGCTACTCGCTGCGGGAAATT
TGCAAATTTGCAACCAAGCGCGACTACACAGCCGTCATCCTCATCAAGGAGGACCTCAAGAAGCCTACCGGTCTT
TCCATCGTCCACCTGCCCTCGGGTCCAACCTGTCACTTTAGTATAACAAATTATCTCGAGGGCAAAAAGCTTCCG
GGCCACGGTAACCCAACCAGCCACTATCCGGAGCTCCTCCTCAACAACTTCAAGACACCTCTGGGACTACTCACT
GCCAAGCTCTTTCAGTCGCTCTTCCCTCCAAAGCCCGAGATTCAGGGCCGGCAAGTCGTCACCATGCATAATCAG
CGCGACTACATCTTTGTGCGCCGTCATCGCTACGTCTTTCGTGACAGACGCTCTACCGAAAAGCGCATCGTAGAC
TCCGAGGGCAGGGAAATGAAGGGTGTCGAAAACATTCGCGTGGGACTGCAAGAATTGGGTCCTCAATTCACCCTG
AAGCTGCGCAGAGTAGACAAAGGCATCGGGCGAGCAGGTAGCGAGGGCCAAGATGCCACCCAGTGGGAGTGGAAG
GCTAAAATGGAAAAAGACCGCAAACGGTTCAATTTATAG
Transcript >OphauB2|2859
ATGGGTTTCGACAAACCATCAGCACAGGCGCTTCAGGCGGCCAACAAGATGAAGCGAAAGGAACTTTTTGTCCGG
CACAAAAAAGCTACGGGCAAGGAGCGTCGAGAGGAGCGGCTCCGGCGACGCAAGGAGGAACAGCGCGACCCTGCG
CTCAAGGCGGTCAGATTAGCCAAAAATAAAACGGTGACGCTTGACCAGAAGCGAGTATGGGATGAAGGCGACGAC
GACAGCCTGGGCGCCAGAGTTGATTTGGAGAAGCTGCAGCGGCAGCGCTTGGAACAGGCCGAGGCCGAGGAGCAG
GAGGCTCTCGATGCGGGGAGCAAGCACGGGGACAAGGATGACAATGACAGCATGTTGGGCTCGGATGACGAGAAT
GACGACATGTTGCAAGCTTGTAGAGATGAGCATGGACAACAGCAACGCATTCAGAGAGGTGGCAGTATCGCCCCC
TCAACGGCAAGCACCAACCTCGATCTTGCGCCTTCGTCGCTTGCCCTCAAGTTCCCCTCGCTCTTCTCCGACATA
CCGCCAGCCGACTCCAAAATTCTCGTCACTACATCGCTAAACGCCACCATTCACGACCAGGCGCAGCTCATATCG
ACCCTCTTTCCCAACAGCACATATGTTCCCCGCTCTGGACACCGTTACGCCTACCGCTACTCGCTGCGGGAAATT
TGCAAATTTGCAACCAAGCGCGACTACACAGCCGTCATCCTCATCAAGGAGGACCTCAAGAAGCCTACCGGTCTT
TCCATCGTCCACCTGCCCTCGGGTCCAACCTGTCACTTTAGTATAACAAATTATCTCGAGGGCAAAAAGCTTCCG
GGCCACGGTAACCCAACCAGCCACTATCCGGAGCTCCTCCTCAACAACTTCAAGACACCTCTGGGACTACTCACT
GCCAAGCTCTTTCAGTCGCTCTTCCCTCCAAAGCCCGAGATTCAGGGCCGGCAAGTCGTCACCATGCATAATCAG
CGCGACTACATCTTTGTGCGCCGTCATCGCTACGTCTTTCGTGACAGACGCTCTACCGAAAAGCGCATCGTAGAC
TCCGAGGGCAGGGAAATGAAGGGTGTCGAAAACATTCGCGTGGGACTGCAAGAATTGGGTCCTCAATTCACCCTG
AAGCTGCGCAGAGTAGACAAAGGCATCGGGCGAGCAGGTAGCGAGGGCCAAGATGCCACCCAGTGGGAGTGGAAG
GCTAAAATGGAAAAAGACCGCAAACGGTTCAATTTATAG
Gene >OphauB2|2859
ATGGGTTTCGACAAACCATCAGCACAGGCGCTTCAGGCGGCCAACAAGATGAAGCGAAAGGAACTTTTTGTCCGG
CACAAAAAAGCTACGGGCAAGGAGCGTCGAGAGGAGCGGCTCCGGCGACGCAAGGAGGAACAGCGCGACCCTGCG
CTCAAGGCGGTCAGATTAGCCAAAAATAAAACGGTGACGCTTGACCAGAAGCGAGTATGGGATGAAGGCGACGAC
GACAGCCTGGGCGCCAGAGTTGATTTGGAGAAGCTGCAGCGGCAGCGCTTGGAACAGGCCGAGGCCGAGGAGCAG
GAGGCTCTCGATGCGGGGAGCAAGCACGGGGACAAGGATGACAATGACAGCATGTTGGGCTCGGATGACGAGAAT
GACGACATGTTGCAAGCTTGTAGAGATGAGCATGGACAACAGCAACGCATTCAGAGAGGTGGCAGTATCGCCCCC
TCAACGGCAAGCACCAACCTCGATCTTGCGCCTTCGTCGCTTGCCCTCAAGTTCCCCTCGCTCTTCTCCGACATA
CCGCCAGCCGACTCCAAAATTCTCGTCACTACATCGCTAAACGCCACCATTCACGACCAGGCGCAGCTCATATCG
ACCCTCTTTCCCAACAGCACATATGTTCCCCGCTCTGGACACCGTTACGCCTACCGCTACTCGCTGCGGGAAATT
TGCAAATTTGCAACCAAGCGCGACTACACAGCCGTCATCCTCATCAAGGAGGACCTCAAGAAGCCTACCGGTCTT
TCCATCGTCCACCTGCCCTCGGGTCCAACCTGTCACTTTAGTATAACAAATTATCTCGAGGGCAAAAAGCTTCCG
GGCCACGGTAACCCAACCAGCCACTATCCGGAGCTCCTCCTCAACAACTTCAAGACACCTCTGGGACTACTCACT
GCCAAGCTCTTTCAGTCGCTCTTCCCTCCAAAGCCCGAGATTCAGGGCCGGCAAGTCGTCACCATGCATAATCAG
CGCGACTACATCTTTGTGCGCCGTCATCGCTACGTCTTTCGTGACAGACGCTCTACCGAAAAGCGCATCGTAGAC
TCCGAGGGCAGGGAAATGAAGGGTGTCGAAAACATTCGCGTGGGACTGCAAGAATTGGGTCCTCAATTCACCCTG
AAGCTGCGCAGAGTAGACAAAGGCATCGGGCGAGCAGGTAGCGAGGGCCAAGATGCCACCCAGTGGGAGTGGAAG
GCTAAAATGGAAAAAGACCGCAAACGGTTCAATTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail