Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2854
Gene name
LocationContig_195:33730..36365
Strand+
Gene length (bp)2635
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 2.2E-81 7 417
PF07976 Phe_hydrox_dim Phenol hydroxylase, C-terminal dimerisation domain 7.3E-45 450 638

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15245|PH2M_TRICU Phenol 2-monooxygenase OS=Trichosporon cutaneum PE=1 SV=3 3 671 6.0E-174
sp|Q6SSJ6|MOBA_COMTE 3-hydroxybenzoate 4-monooxygenase OS=Comamonas testosteroni GN=mobA PE=1 SV=1 2 672 7.0E-107
sp|B7N8Q4|MHPA_ECOLU 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mhpA PE=3 SV=1 2 415 3.0E-22
sp|B7NK08|MHPA_ECO7I 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mhpA PE=3 SV=1 2 415 3.0E-22
sp|B1LIN2|MHPA_ECOSM 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mhpA PE=3 SV=1 2 415 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15245|PH2M_TRICU Phenol 2-monooxygenase OS=Trichosporon cutaneum PE=1 SV=3 3 671 6.0E-174
sp|Q6SSJ6|MOBA_COMTE 3-hydroxybenzoate 4-monooxygenase OS=Comamonas testosteroni GN=mobA PE=1 SV=1 2 672 7.0E-107
sp|B7N8Q4|MHPA_ECOLU 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mhpA PE=3 SV=1 2 415 3.0E-22
sp|B7NK08|MHPA_ECO7I 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mhpA PE=3 SV=1 2 415 3.0E-22
sp|B1LIN2|MHPA_ECOSM 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mhpA PE=3 SV=1 2 415 3.0E-22
sp|O07561|YHJG_BACSU Uncharacterized aromatic compound monooxygenase YhjG OS=Bacillus subtilis (strain 168) GN=yhjG PE=3 SV=1 8 425 5.0E-22
sp|B6HZX3|MHPA_ECOSE 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain SE11) GN=mhpA PE=3 SV=1 2 415 5.0E-22
sp|A7ZWZ4|MHPA_ECOHS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O9:H4 (strain HS) GN=mhpA PE=3 SV=1 2 415 5.0E-22
sp|A7ZI94|MHPA_ECO24 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mhpA PE=3 SV=1 2 415 5.0E-22
sp|B5Z2Q2|MHPA_ECO5E 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mhpA PE=3 SV=1 2 415 9.0E-22
sp|Q8X680|MHPA_ECO57 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O157:H7 GN=mhpA PE=3 SV=1 2 415 9.0E-22
sp|B7L503|MHPA_ECO55 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain 55989 / EAEC) GN=mhpA PE=3 SV=1 2 415 3.0E-21
sp|B7M2Z5|MHPA_ECO8A 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O8 (strain IAI1) GN=mhpA PE=3 SV=1 2 415 5.0E-21
sp|P42535|PCPB_SPHCR Pentachlorophenol 4-monooxygenase OS=Sphingobium chlorophenolicum GN=pcpB PE=1 SV=4 9 448 1.0E-19
sp|Q9S158|MHPA_COMTE 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Comamonas testosteroni GN=mhpA PE=3 SV=1 208 425 4.0E-19
sp|P39888|TCMG_STRGA Tetracenomycin polyketide synthesis hydroxylase TcmG OS=Streptomyces glaucescens GN=tcmG PE=3 SV=1 3 423 4.0E-19
sp|A0R1T4|MHPA_MYCS2 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mhpA PE=3 SV=2 1 425 5.0E-19
sp|Q3Z585|MHPA_SHISS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Shigella sonnei (strain Ss046) GN=mhpA PE=3 SV=1 197 415 3.0E-18
sp|A1TCX2|MHPA_MYCVP 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mhpA PE=3 SV=1 13 415 4.0E-18
sp|Q13QI0|MHPA_BURXL 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Burkholderia xenovorans (strain LB400) GN=mhpA PE=3 SV=1 208 425 9.0E-18
sp|A4JPY1|MHPA1_BURVG 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mhpA1 PE=3 SV=1 180 425 1.0E-17
sp|P27138|TFDB_CUPPJ 2,4-dichlorophenol 6-monooxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdB PE=3 SV=1 1 420 1.0E-17
sp|P77397|MHPA_ECOLI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain K12) GN=mhpA PE=1 SV=1 197 415 1.0E-17
sp|B1XBJ4|MHPA_ECODH 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain K12 / DH10B) GN=mhpA PE=3 SV=1 197 415 1.0E-17
sp|B7MPB4|MHPA_ECO81 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O81 (strain ED1a) GN=mhpA PE=3 SV=1 210 415 2.0E-17
sp|B5XQI9|MHPA_KLEP3 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Klebsiella pneumoniae (strain 342) GN=mhpA PE=3 SV=1 192 415 2.0E-16
sp|A6TAC9|MHPA_KLEP7 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mhpA PE=3 SV=1 192 415 2.0E-16
sp|A0KE38|MHPA_BURCH 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Burkholderia cenocepacia (strain HI2424) GN=mhpA PE=3 SV=1 162 444 4.0E-16
sp|Q1BGA7|MHPA_BURCA 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Burkholderia cenocepacia (strain AU 1054) GN=mhpA PE=3 SV=1 162 444 4.0E-16
sp|P31020|PHEA_PSEUE Phenol 2-monooxygenase OS=Pseudomonas sp. (strain EST1001) GN=pheA PE=3 SV=1 211 415 1.0E-15
sp|Q476N1|MHPA_CUPPJ 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mhpA PE=3 SV=1 211 425 1.0E-15
sp|A4JQH4|MHPA2_BURVG 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mhpA2 PE=3 SV=1 4 454 4.0E-15
sp|A0QB57|MHPA_MYCA1 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium avium (strain 104) GN=mhpA PE=3 SV=1 216 425 1.0E-14
sp|Q742Z1|MHPA_MYCPA 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mhpA PE=3 SV=1 216 425 1.0E-14
sp|A4T8B6|MHPA_MYCGI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium gilvum (strain PYR-GCK) GN=mhpA PE=3 SV=1 211 425 1.0E-14
sp|A3Q339|MHPA_MYCSJ 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain JLS) GN=mhpA PE=3 SV=1 216 425 2.0E-14
sp|Q1B5E2|MHPA_MYCSS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain MCS) GN=mhpA PE=3 SV=1 216 425 2.0E-14
sp|A1UJP4|MHPA_MYCSK 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain KMS) GN=mhpA PE=3 SV=1 216 425 2.0E-14
sp|Q58PK7|OTCC_STRRM Anhydrotetracycline monooxygenase OS=Streptomyces rimosus GN=otcC PE=1 SV=1 216 415 1.0E-13
sp|Q8KN28|TFDB_DELAC 2,4-dichlorophenol 6-monooxygenase OS=Delftia acidovorans GN=tfdB PE=1 SV=3 216 415 2.0E-11
sp|P42534|HYDL_STRCO Putative polyketide hydroxylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5321 PE=3 SV=2 190 416 3.0E-10
sp|Q05355|HYDL_STRHA Putative polyketide hydroxylase OS=Streptomyces halstedii GN=schC PE=3 SV=1 209 410 3.0E-10
sp|Q01551|TBUD_RALPI Phenol 2-monooxygenase OS=Ralstonia pickettii GN=tbuD PE=1 SV=2 328 424 1.0E-06
sp|Q58PK7|OTCC_STRRM Anhydrotetracycline monooxygenase OS=Streptomyces rimosus GN=otcC PE=1 SV=1 8 74 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2854
MAAQSHVDVVIIGAGPSGLMLALWMAKLGVKTRVIDKRSRKVFSGQADGLQVRTLEILDSFGIGSQVWNEANHLI
EICFWSADEQDKTRIRRDARLPDTMVGLSRFTQSVLHQGRIESYLLDAIRESECQPDNAQVKIDRSVVPTALRID
EALAVSNDDDAHPVEVTLRHLSDDESLVPQRLSDQPDGLHRSNLGDDDTPSLLGRSADRQGVEETVRAKYLVGCD
GAHSWTRKTLGSGFEMVGESTDAIWGVLDIVPITDFPDIRNRCVVSSANAGTIMIIPREHRMVRLYVELAVVPEA
STGRVDRSALTPQLILQTARDILHPYKLDYHYLDWWTAYQIGQRCGQRFSKLDRVFLAGDAVHTHSPKAGQGMNT
SMQDTYNLGWKLGLVCKKMLQRSVLSTYELERRQVAQQLIAFDQKFSRLFLRQACRGKGRHNGELQDEVEGSQMF
VTGVGICYPPSELVWPGDCLDSSKGSKQELATACRPGTRLASHRVLGQADARPWELHCLMPSDGRFRIFVFGGNV
TPGGPQLALVNQLGQWLHTELLGRYRQMSLVAGHRMTPGWTKFPAQQALSLIDVVLVHTAPRDDVALDDLHPVYH
PFDAKLGWDYNKTFIDAASYHDGYDKAYEKYGIDAHRGAMLVVRPDGHVGLVSSLDDEGRRKVGHWFDGVLRRHE
*
Coding >OphauB2|2854
ATGGCCGCACAATCACACGTTGACGTTGTCATCATTGGTGCCGGCCCCTCAGGGCTGATGCTAGCCCTCTGGATG
GCCAAGCTGGGCGTCAAGACACGCGTCATTGACAAGCGGTCCCGCAAAGTCTTTTCCGGCCAAGCTGACGGCCTT
CAAGTTCGGACCCTGGAGATTCTGGACAGCTTCGGCATTGGCTCCCAAGTGTGGAACGAAGCCAACCATTTAATC
GAAATCTGCTTTTGGAGCGCAGATGAGCAGGACAAGACGCGCATCCGGCGAGATGCGCGTCTTCCAGACACAATG
GTGGGCCTCTCGCGCTTTACGCAGTCGGTGCTGCACCAGGGCCGCATCGAGAGCTACCTCCTGGATGCCATTCGC
GAATCGGAATGTCAGCCAGACAATGCCCAAGTCAAGATCGATCGCAGCGTGGTGCCAACGGCTCTGCGCATCGAC
GAAGCCCTGGCCGTCAGCAACGACGACGACGCACACCCCGTAGAGGTGACACTGCGGCACCTTTCCGACGACGAG
TCGCTTGTGCCGCAGCGGCTCAGCGACCAGCCCGATGGGTTGCACAGGAGCAACCTGGGCGACGACGACACGCCA
AGTCTGCTGGGGCGCAGTGCAGACCGACAGGGCGTCGAGGAGACGGTGCGGGCAAAATACCTCGTTGGATGTGAC
GGAGCCCACTCGTGGACGCGCAAGACTCTGGGCAGTGGCTTCGAAATGGTTGGAGAGTCGACAGATGCCATTTGG
GGTGTACTAGATATTGTTCCTATCACCGACTTTCCCGACATCAGAAACCGCTGTGTTGTGAGCAGCGCCAATGCG
GGTACTATCATGATTATTCCGCGCGAGCACAGAATGGTCAGACTCTATGTCGAGCTGGCCGTGGTGCCAGAGGCG
TCGACGGGGCGAGTGGACCGATCTGCCCTGACACCCCAGCTCATCCTCCAGACGGCACGAGATATCCTGCATCCA
TATAAGCTTGATTATCATTACTTGGACTGGTGGACGGCATACCAAATTGGCCAGCGGTGCGGCCAGCGTTTCAGC
AAGCTTGACCGAGTCTTCCTGGCCGGAGATGCAGTGCATACCCACTCCCCCAAGGCGGGCCAAGGGATGAACACG
TCGATGCAGGACACGTACAACCTGGGCTGGAAGCTGGGCCTGGTGTGTAAGAAGATGTTGCAGCGCAGCGTGCTG
TCGACATATGAGCTCGAGCGACGACAGGTGGCCCAGCAGCTCATTGCCTTTGACCAAAAGTTCTCGCGCCTCTTT
CTCAGACAGGCATGCCGGGGCAAGGGGCGACACAATGGCGAGCTACAAGACGAGGTAGAAGGGAGCCAAATGTTT
GTGACAGGAGTCGGCATTTGCTATCCGCCAAGCGAGCTCGTATGGCCGGGCGACTGCTTGGACAGCAGCAAGGGT
AGCAAGCAGGAGCTGGCGACGGCGTGCAGGCCCGGGACTCGTCTGGCGTCCCATCGAGTGCTGGGTCAGGCCGAC
GCGCGACCCTGGGAGCTGCACTGCCTGATGCCTTCTGACGGTCGCTTCCGCATCTTTGTCTTTGGCGGCAACGTG
ACACCAGGGGGGCCGCAGCTGGCACTCGTCAACCAGCTGGGTCAGTGGCTGCACACGGAGCTGCTTGGCCGGTAC
AGGCAGATGAGCCTGGTAGCCGGCCACCGCATGACGCCGGGCTGGACAAAGTTCCCAGCACAGCAAGCGCTGTCT
TTGATTGATGTGGTGCTAGTGCACACGGCTCCGCGTGACGACGTGGCGCTCGACGACTTGCACCCCGTCTATCAC
CCCTTTGATGCCAAGCTAGGCTGGGACTATAACAAGACATTCATCGACGCCGCCAGCTACCATGACGGCTACGAC
AAAGCCTATGAGAAGTACGGCATTGACGCCCACCGCGGCGCCATGCTTGTCGTTCGTCCCGACGGCCATGTTGGT
CTCGTCAGCTCTCTCGACGACGAGGGGAGGCGCAAGGTGGGCCATTGGTTTGACGGTGTGTTGCGAAGGCACGAA
TAG
Transcript >OphauB2|2854
ATGGCCGCACAATCACACGTTGACGTTGTCATCATTGGTGCCGGCCCCTCAGGGCTGATGCTAGCCCTCTGGATG
GCCAAGCTGGGCGTCAAGACACGCGTCATTGACAAGCGGTCCCGCAAAGTCTTTTCCGGCCAAGCTGACGGCCTT
CAAGTTCGGACCCTGGAGATTCTGGACAGCTTCGGCATTGGCTCCCAAGTGTGGAACGAAGCCAACCATTTAATC
GAAATCTGCTTTTGGAGCGCAGATGAGCAGGACAAGACGCGCATCCGGCGAGATGCGCGTCTTCCAGACACAATG
GTGGGCCTCTCGCGCTTTACGCAGTCGGTGCTGCACCAGGGCCGCATCGAGAGCTACCTCCTGGATGCCATTCGC
GAATCGGAATGTCAGCCAGACAATGCCCAAGTCAAGATCGATCGCAGCGTGGTGCCAACGGCTCTGCGCATCGAC
GAAGCCCTGGCCGTCAGCAACGACGACGACGCACACCCCGTAGAGGTGACACTGCGGCACCTTTCCGACGACGAG
TCGCTTGTGCCGCAGCGGCTCAGCGACCAGCCCGATGGGTTGCACAGGAGCAACCTGGGCGACGACGACACGCCA
AGTCTGCTGGGGCGCAGTGCAGACCGACAGGGCGTCGAGGAGACGGTGCGGGCAAAATACCTCGTTGGATGTGAC
GGAGCCCACTCGTGGACGCGCAAGACTCTGGGCAGTGGCTTCGAAATGGTTGGAGAGTCGACAGATGCCATTTGG
GGTGTACTAGATATTGTTCCTATCACCGACTTTCCCGACATCAGAAACCGCTGTGTTGTGAGCAGCGCCAATGCG
GGTACTATCATGATTATTCCGCGCGAGCACAGAATGGTCAGACTCTATGTCGAGCTGGCCGTGGTGCCAGAGGCG
TCGACGGGGCGAGTGGACCGATCTGCCCTGACACCCCAGCTCATCCTCCAGACGGCACGAGATATCCTGCATCCA
TATAAGCTTGATTATCATTACTTGGACTGGTGGACGGCATACCAAATTGGCCAGCGGTGCGGCCAGCGTTTCAGC
AAGCTTGACCGAGTCTTCCTGGCCGGAGATGCAGTGCATACCCACTCCCCCAAGGCGGGCCAAGGGATGAACACG
TCGATGCAGGACACGTACAACCTGGGCTGGAAGCTGGGCCTGGTGTGTAAGAAGATGTTGCAGCGCAGCGTGCTG
TCGACATATGAGCTCGAGCGACGACAGGTGGCCCAGCAGCTCATTGCCTTTGACCAAAAGTTCTCGCGCCTCTTT
CTCAGACAGGCATGCCGGGGCAAGGGGCGACACAATGGCGAGCTACAAGACGAGGTAGAAGGGAGCCAAATGTTT
GTGACAGGAGTCGGCATTTGCTATCCGCCAAGCGAGCTCGTATGGCCGGGCGACTGCTTGGACAGCAGCAAGGGT
AGCAAGCAGGAGCTGGCGACGGCGTGCAGGCCCGGGACTCGTCTGGCGTCCCATCGAGTGCTGGGTCAGGCCGAC
GCGCGACCCTGGGAGCTGCACTGCCTGATGCCTTCTGACGGTCGCTTCCGCATCTTTGTCTTTGGCGGCAACGTG
ACACCAGGGGGGCCGCAGCTGGCACTCGTCAACCAGCTGGGTCAGTGGCTGCACACGGAGCTGCTTGGCCGGTAC
AGGCAGATGAGCCTGGTAGCCGGCCACCGCATGACGCCGGGCTGGACAAAGTTCCCAGCACAGCAAGCGCTGTCT
TTGATTGATGTGGTGCTAGTGCACACGGCTCCGCGTGACGACGTGGCGCTCGACGACTTGCACCCCGTCTATCAC
CCCTTTGATGCCAAGCTAGGCTGGGACTATAACAAGACATTCATCGACGCCGCCAGCTACCATGACGGCTACGAC
AAAGCCTATGAGAAGTACGGCATTGACGCCCACCGCGGCGCCATGCTTGTCGTTCGTCCCGACGGCCATGTTGGT
CTCGTCAGCTCTCTCGACGACGAGGGGAGGCGCAAGGTGGGCCATTGGTTTGACGGTGTGTTGCGAAGGCACGAA
TAG
Gene >OphauB2|2854
ATGGCCGCACAATCACACGTTGACGTTGTCATCATTGGTGCCGGCCCCTCAGGGCTGATGCTAGCCCTCTGGATG
GCCAAGCTGGGCGTCAAGACACGCGTCATTGACAAGCGGTCCCGCAAAGTCTTTTCCGGCCAAGCTGACGGGTGG
GTTGCCTCTGCATGGGTGAGCAAACAAGACGCAGGAGCTGATGTGACGGGGGTTGCAGCCTTCAAGTTCGGACCC
TGGAGATTCTGGACAGCTTCGGCATTGGCTCCCAAGTGTGGAACGAAGCCAACCATTTAATCGGTATGCCCGTGC
CAGTGTCGTGACCAAGGTAACCCACTCTCTGGGCGCGCATCCCTAACGGGCGTGTAGAAATCTGCTTTTGGAGCG
CAGATGAGCAGGACAAGACGCGCATCCGGCGAGATGCGCGTCTTCCAGACACAATGGTGGGCCTCTCGCGCTTTA
CGCAGTCGGTGCTGCACCAGGGCCGCATCGAGAGCTACCTCCTGGATGCCATTCGCGAATCGGAATGTCAGCCAG
ACAATGCCCAAGTCAAGATCGATCGCAGCGTGGTGCCAACGGCTCTGCGCATCGACGAAGCCCTGGCCGTCAGCA
ACGACGACGACGCACACCCCGTAGAGGTGACACTGCGGCACCTTTCCGACGACGAGTCGCTTGTGCCGCAGCGGC
TCAGCGACCAGCCCGATGGGTTGCACAGGAGCAACCTGGGCGACGACGACACGCCAAGTCTGCTGGGGCGCAGTG
CAGACCGACAGGGCGTCGAGGAGACGGTGCGGGCAAAATACCTCGTTGGATGTGACGGAGCCCACTCGTGGACGC
GCAAGACTCTGGGCAGTGGCTTCGAAATGGTTGGAGAGTCGACAGATGCCATTTGGTGAGTCGACATGTCACGAA
AAGGAGGGGGCCCAGAGCAAGATATCCTTGCTCCCTGGCGTCTGGACAAAAACACGCGTGTGCATACAGTATGGC
TTCCGGCTGACGGTGGGCGGATTAAACCACCCATTGACAACAGGGGTGTACTAGATATTGTTCCTATCACCGACT
TTCGTGAGTTGTGACAGACGTCGAGACTCGTGGGGGCACACCCGGGGGCATGCATGGCTGACGCGGCTCCTCTTG
TCGTAGCCGACATCAGAAACCGCTGTGTTGTGAGCAGCGCCAATGCGGGTACTATCATGATTATTCCGCGCGAGC
ACAGAATGGTCAGACTCTATGTCGAGCTGGCCGTGGTGCCAGAGGCGTCGACGGGGCGAGTGGACCGATCTGCCC
TGACACCCCAGCTCATCCTCCAGACGGCACGAGATATCCTGCATCCATATAAGCTTGATTATCATTACTTGGACT
GGTAAGTCGACAGCGCACCAGTCAGCAGTGCTTGTGGCAAAGGCCTAATGTCTCTGCAAGGTGGACGGCATACCA
AATTGGCCAGCGGTGCGGCCAGCGTTTCAGCAAGCTTGACCGAGTCTTCCTGGCCGGAGGTTTGTGTGCCCCCCC
ACTACTACCGACACGGCTCTGCCAGTATGCTCTTCAAAGACAGTGCTTGGAGTGCAAATCAAACGTCTCAGAGAC
TGACTCTACTTGCCACTGCAGATGCAGTGCATACCCACTCCCCCAAGGCGGGCCAAGGGATGAACACGTCGATGC
AGGACACGTACAACCTGGGCTGGAAGCTGGGCCTGGTGTGTAAGAAGATGTTGCAGCGCAGCGTGCTGTCGACAT
ATGAGCTCGAGCGACGACAGGTGGCCCAGCAGCTCATTGCCTTTGACCAAAAGTTCTCGCGCCTCTTTCTCAGAC
AGGCATGCCGGGGCAAGGGGCGACACAATGGCGAGCTACAAGACGAGGTAGAAGGGAGCCAAATGGTGAGTTGCA
TGTTGCAATTTCAAAGCCAAGAGCGAGGCCGGCATCATTGTGCAACGTGGAACGCGTGCGTGTCTGACAGCAAGG
GCAGTTTGTGACAGGAGTCGGCATTTGCTATCCGCCAAGCGAGCTCGTATGGCCGGGCGACTGCTTGGACAGCAG
CAAGGGTAGCAAGCAGGAGCTGGCGACGGCGTGCAGGCCCGGGACTCGTCTGGCGTCCCATCGAGTGCTGGGTCA
GGCCGACGCGCGACCCTGGGAGCTGCACTGCCTGATGCCTTCTGACGGTCGCTTCCGCATCTTTGTCTTTGGCGG
CAACGTGACACCAGGGGGGCCGCAGCTGGCACTCGTCAACCAGCTGGGTCAGTGGCTGCACACGGAGCTGCTTGG
CCGGTACAGGCAGATGAGCCTGGTAGCCGGCCACCGCATGACGCCGGGCTGGACAAAGTTCCCAGCACAGCAAGC
GCTGTCTTTGATTGATGTGGTGCTAGTGCACACGGCTCCGCGTGACGACGTGGCGCTCGACGACTTGCACCCCGT
CTATCACCCCTTTGATGCCAAGCTAGGCTGGGACTATAACAAGACATTCATCGACGCCGCCAGCTACCATGACGG
CTACGACAAAGCCTATGAGAAGTACGGCATTGACGCCCACCGCGGCGCCATGCTTGTCGTTCGTCCCGACGGCCA
TGTTGGTCTCGTCAGCTCTCTCGACGACGAGGGGAGGCGCAAGGTGGGCCATTGGTTTGACGGTGTGTTGCGAAG
GCACGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail