Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2846
Gene name
LocationContig_195:11180..11591
Strand+
Gene length (bp)411
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02297 COX6B Cytochrome oxidase c subunit VIb 1.5E-19 23 97

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRP6|COA6_SCHPO Cytochrome c oxidase subunit 6B-like protein new16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=new16 PE=2 SV=1 19 108 4.0E-19
sp|Q3E846|COA6_YEAST Cytochrome c oxidase assembly factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA6 PE=1 SV=1 25 107 8.0E-18
sp|Q5JTJ3|COA6_HUMAN Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens GN=COA6 PE=1 SV=1 6 87 6.0E-06

GO

GO Term Description Terminal node
GO:0045277 respiratory chain complex IV Yes
GO:0005739 mitochondrion Yes
GO:0110165 cellular anatomical entity No
GO:0032991 protein-containing complex No
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0098803 respiratory chain complex No
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0098796 membrane protein complex No
GO:0070069 cytochrome complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5852
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2257
Ophiocordyceps australis map64 (Brazil) OphauB2|2846 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00567
Ophiocordyceps camponoti-rufipedis Ophun1|7573
Ophiocordyceps kimflemingae Ophio5|1217

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2846
MPWWWPFSPSDPRADAIRSGTAIPTRDERQRCWASRDAFFACLDTHNIINTTTPAGATAARKACPADNAAFERDC
SASWVTYFRQWRVADAKKKKALEELREQGAEQLPVTTSFSPKPTTTKQDIHALLEEKRRSS*
Coding >OphauB2|2846
ATGCCCTGGTGGTGGCCCTTTTCCCCCTCGGACCCCCGAGCCGATGCCATTCGCTCCGGCACCGCCATTCCCACT
CGCGACGAGCGTCAGCGCTGCTGGGCCTCGCGCGACGCCTTTTTTGCCTGCCTCGACACCCACAATATTATAAAC
ACAACCACCCCGGCCGGCGCCACGGCTGCCCGCAAGGCCTGCCCGGCCGACAATGCAGCCTTTGAGCGCGACTGC
TCCGCCTCCTGGGTCACCTACTTTAGGCAGTGGCGCGTCGCCGATGCCAAGAAGAAGAAGGCGCTTGAGGAGCTG
CGCGAGCAGGGCGCAGAGCAACTCCCCGTCACGACTAGCTTTAGCCCAAAGCCAACAACCACCAAGCAAGACATT
CATGCTTTGCTCGAGGAGAAGCGGAGGTCGTCTTGA
Transcript >OphauB2|2846
ATGCCCTGGTGGTGGCCCTTTTCCCCCTCGGACCCCCGAGCCGATGCCATTCGCTCCGGCACCGCCATTCCCACT
CGCGACGAGCGTCAGCGCTGCTGGGCCTCGCGCGACGCCTTTTTTGCCTGCCTCGACACCCACAATATTATAAAC
ACAACCACCCCGGCCGGCGCCACGGCTGCCCGCAAGGCCTGCCCGGCCGACAATGCAGCCTTTGAGCGCGACTGC
TCCGCCTCCTGGGTCACCTACTTTAGGCAGTGGCGCGTCGCCGATGCCAAGAAGAAGAAGGCGCTTGAGGAGCTG
CGCGAGCAGGGCGCAGAGCAACTCCCCGTCACGACTAGCTTTAGCCCAAAGCCAACAACCACCAAGCAAGACATT
CATGCTTTGCTCGAGGAGAAGCGGAGGTCGTCTTGA
Gene >OphauB2|2846
ATGCCCTGGTGGTGGCCCTTTTCCCCCTCGGACCCCCGAGCCGATGCCATTCGCTCCGGCACCGCCATTCCCACT
CGCGACGAGCGTCAGCGCTGCTGGGCCTCGCGCGACGCCTTTTTTGCCTGCCTCGACACCCACAATATTATAAAC
ACAACCACCCCGGCCGGCGCCACGGCTGCCCGCAAGGCCTGCCCGGCCGACAATGCAGCCTTTGAGCGCGACTGC
TCCGCCTCCTGGGTCACCTACTTTAGGCAGTGGCGCGTCGCCGATGCCAAGAAGAAGAAGGCGCTTGAGGAGCTG
CGCGAGCAGGGCGCAGAGCAACTCCCCGTCACGACTAGCTTTAGCCCAAAGCCAACAACCACCAAGCAAGACATT
CATGCTTTGCTCGAGGAGAAGCGGAGGTCGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail