Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2846
Gene name
LocationContig_195:11180..11591
Strand+
Gene length (bp)411
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02297 COX6B Cytochrome oxidase c subunit VIb 1.5E-19 23 97

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G2TRP6|COA6_SCHPO Cytochrome c oxidase subunit 6B-like protein new16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=new16 PE=2 SV=1 19 108 4.0E-19
sp|Q3E846|COA6_YEAST Cytochrome c oxidase assembly factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA6 PE=1 SV=1 25 107 8.0E-18
sp|Q5JTJ3|COA6_HUMAN Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens GN=COA6 PE=1 SV=1 6 87 6.0E-06

GO

GO Term Description Terminal node
GO:0045277 respiratory chain complex IV Yes
GO:0005739 mitochondrion Yes
GO:0110165 cellular anatomical entity No
GO:0032991 protein-containing complex No
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0098803 respiratory chain complex No
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0098796 membrane protein complex No
GO:0070069 cytochrome complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2846
MPWWWPFSPSDPRADAIRSGTAIPTRDERQRCWASRDAFFACLDTHNIINTTTPAGATAARKACPADNAAFERDC
SASWVTYFRQWRVADAKKKKALEELREQGAEQLPVTTSFSPKPTTTKQDIHALLEEKRRSS*
Coding >OphauB2|2846
ATGCCCTGGTGGTGGCCCTTTTCCCCCTCGGACCCCCGAGCCGATGCCATTCGCTCCGGCACCGCCATTCCCACT
CGCGACGAGCGTCAGCGCTGCTGGGCCTCGCGCGACGCCTTTTTTGCCTGCCTCGACACCCACAATATTATAAAC
ACAACCACCCCGGCCGGCGCCACGGCTGCCCGCAAGGCCTGCCCGGCCGACAATGCAGCCTTTGAGCGCGACTGC
TCCGCCTCCTGGGTCACCTACTTTAGGCAGTGGCGCGTCGCCGATGCCAAGAAGAAGAAGGCGCTTGAGGAGCTG
CGCGAGCAGGGCGCAGAGCAACTCCCCGTCACGACTAGCTTTAGCCCAAAGCCAACAACCACCAAGCAAGACATT
CATGCTTTGCTCGAGGAGAAGCGGAGGTCGTCTTGA
Transcript >OphauB2|2846
ATGCCCTGGTGGTGGCCCTTTTCCCCCTCGGACCCCCGAGCCGATGCCATTCGCTCCGGCACCGCCATTCCCACT
CGCGACGAGCGTCAGCGCTGCTGGGCCTCGCGCGACGCCTTTTTTGCCTGCCTCGACACCCACAATATTATAAAC
ACAACCACCCCGGCCGGCGCCACGGCTGCCCGCAAGGCCTGCCCGGCCGACAATGCAGCCTTTGAGCGCGACTGC
TCCGCCTCCTGGGTCACCTACTTTAGGCAGTGGCGCGTCGCCGATGCCAAGAAGAAGAAGGCGCTTGAGGAGCTG
CGCGAGCAGGGCGCAGAGCAACTCCCCGTCACGACTAGCTTTAGCCCAAAGCCAACAACCACCAAGCAAGACATT
CATGCTTTGCTCGAGGAGAAGCGGAGGTCGTCTTGA
Gene >OphauB2|2846
ATGCCCTGGTGGTGGCCCTTTTCCCCCTCGGACCCCCGAGCCGATGCCATTCGCTCCGGCACCGCCATTCCCACT
CGCGACGAGCGTCAGCGCTGCTGGGCCTCGCGCGACGCCTTTTTTGCCTGCCTCGACACCCACAATATTATAAAC
ACAACCACCCCGGCCGGCGCCACGGCTGCCCGCAAGGCCTGCCCGGCCGACAATGCAGCCTTTGAGCGCGACTGC
TCCGCCTCCTGGGTCACCTACTTTAGGCAGTGGCGCGTCGCCGATGCCAAGAAGAAGAAGGCGCTTGAGGAGCTG
CGCGAGCAGGGCGCAGAGCAACTCCCCGTCACGACTAGCTTTAGCCCAAAGCCAACAACCACCAAGCAAGACATT
CATGCTTTGCTCGAGGAGAAGCGGAGGTCGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail