Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|282
Gene name
LocationContig_100:38985..40174
Strand-
Gene length (bp)1189
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12400 STIMATE STIMATE family 9.2E-41 150 276

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12042|YP162_YEAST Vacuolar membrane protein YPL162C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL162C PE=1 SV=1 56 277 4.0E-33
sp|Q86TL2|STIMA_HUMAN Store-operated calcium entry regulator STIMATE OS=Homo sapiens GN=TMEM110 PE=1 SV=1 49 347 4.0E-32
sp|Q3UF25|STIMA_MOUSE Store-operated calcium entry regulator STIMATE OS=Mus musculus GN=Tmem110 PE=2 SV=1 31 331 6.0E-31
sp|Q7TSW6|STIMA_RAT Store-operated calcium entry regulator STIMATE OS=Rattus norvegicus GN=Tmem110 PE=2 SV=1 54 331 1.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 104 126 22
3 150 172 22
4 210 232 22
5 252 271 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|282
MLQPAVALGAVHHAARTLTATMEASTTALQPSSALAMATTTGTASPASPHDQDSQQGECRLLGPFALLVQLALGG
LALLSLVYKRWRERPQRPVKIWFFDVSKQVFGSVLVHIANVFMSMLTSGRFSVSLDSAVPVVAARSDDSYQPNPC
SFYLLNLAIDTTLGIPILIVLLRVMTALVALTPLGKPTESIQSGNYGSPPNVWWWLKQSVIYFCGLFGMKICVLI
IFLVMPWISMVGDWALGWTEGNERLQIAFVMMIFPLVMNALQYYIIDSFIKMKEPEHQRLPSQDPDQDHVGHRES
SRLRSRIRADRGSEHGGADEHGDQLSKLHHRSLSSGDDEYDPDVDGDAPTVFGSSSSRRGVEQTKATTSHLFPKE
*
Coding >OphauB2|282
ATGCTGCAGCCCGCCGTCGCTCTTGGCGCCGTCCACCATGCCGCTCGCACATTGACGGCCACGATGGAAGCCTCG
ACAACGGCCCTCCAACCATCGTCGGCCCTCGCCATGGCCACCACTACTGGCACTGCCTCTCCCGCTTCTCCCCAT
GATCAAGACTCTCAACAGGGCGAATGTCGTCTGCTCGGTCCTTTTGCCCTCCTCGTCCAGCTGGCTCTTGGCGGT
CTTGCACTCTTGTCGCTCGTGTACAAGCGCTGGCGCGAACGCCCCCAGCGACCTGTCAAGATCTGGTTCTTTGAC
GTCTCTAAACAAGTCTTTGGCTCTGTCCTGGTCCACATTGCCAATGTTTTCATGTCCATGCTTACCAGTGGCCGC
TTCTCCGTGAGCCTCGACTCTGCCGTTCCTGTCGTTGCTGCCAGGTCCGACGACTCTTACCAGCCGAATCCATGC
TCCTTTTACCTTCTCAATCTTGCAATCGATACAACCCTTGGCATTCCAATTCTCATTGTACTGCTGCGAGTCATG
ACAGCCCTCGTAGCGTTAACCCCTCTCGGTAAGCCTACCGAGTCGATACAGTCGGGCAATTACGGCAGTCCTCCA
AACGTATGGTGGTGGCTCAAACAGTCCGTCATATACTTCTGCGGCCTGTTTGGCATGAAGATATGCGTTCTCATC
ATCTTCCTCGTTATGCCATGGATATCCATGGTTGGTGACTGGGCTCTAGGCTGGACCGAGGGCAATGAGCGCCTG
CAAATCGCCTTTGTCATGATGATTTTCCCTCTTGTCATGAATGCCTTACAGTATTACATCATTGACTCCTTCATC
AAGATGAAGGAGCCCGAGCATCAACGCCTTCCATCCCAAGACCCGGACCAAGACCATGTCGGGCACAGAGAAAGC
TCTCGGCTGAGGAGCCGCATACGAGCTGATCGCGGTAGCGAACACGGTGGTGCCGACGAGCATGGTGACCAGTTA
TCCAAACTACACCACCGGTCTCTCTCCAGCGGCGACGACGAGTACGACCCGGACGTCGACGGCGATGCCCCGACC
GTCTTTGGAAGCAGCAGCTCGAGACGGGGCGTTGAGCAGACAAAGGCTACAACAAGCCATCTTTTCCCCAAGGAA
TAA
Transcript >OphauB2|282
ATGCTGCAGCCCGCCGTCGCTCTTGGCGCCGTCCACCATGCCGCTCGCACATTGACGGCCACGATGGAAGCCTCG
ACAACGGCCCTCCAACCATCGTCGGCCCTCGCCATGGCCACCACTACTGGCACTGCCTCTCCCGCTTCTCCCCAT
GATCAAGACTCTCAACAGGGCGAATGTCGTCTGCTCGGTCCTTTTGCCCTCCTCGTCCAGCTGGCTCTTGGCGGT
CTTGCACTCTTGTCGCTCGTGTACAAGCGCTGGCGCGAACGCCCCCAGCGACCTGTCAAGATCTGGTTCTTTGAC
GTCTCTAAACAAGTCTTTGGCTCTGTCCTGGTCCACATTGCCAATGTTTTCATGTCCATGCTTACCAGTGGCCGC
TTCTCCGTGAGCCTCGACTCTGCCGTTCCTGTCGTTGCTGCCAGGTCCGACGACTCTTACCAGCCGAATCCATGC
TCCTTTTACCTTCTCAATCTTGCAATCGATACAACCCTTGGCATTCCAATTCTCATTGTACTGCTGCGAGTCATG
ACAGCCCTCGTAGCGTTAACCCCTCTCGGTAAGCCTACCGAGTCGATACAGTCGGGCAATTACGGCAGTCCTCCA
AACGTATGGTGGTGGCTCAAACAGTCCGTCATATACTTCTGCGGCCTGTTTGGCATGAAGATATGCGTTCTCATC
ATCTTCCTCGTTATGCCATGGATATCCATGGTTGGTGACTGGGCTCTAGGCTGGACCGAGGGCAATGAGCGCCTG
CAAATCGCCTTTGTCATGATGATTTTCCCTCTTGTCATGAATGCCTTACAGTATTACATCATTGACTCCTTCATC
AAGATGAAGGAGCCCGAGCATCAACGCCTTCCATCCCAAGACCCGGACCAAGACCATGTCGGGCACAGAGAAAGC
TCTCGGCTGAGGAGCCGCATACGAGCTGATCGCGGTAGCGAACACGGTGGTGCCGACGAGCATGGTGACCAGTTA
TCCAAACTACACCACCGGTCTCTCTCCAGCGGCGACGACGAGTACGACCCGGACGTCGACGGCGATGCCCCGACC
GTCTTTGGAAGCAGCAGCTCGAGACGGGGCGTTGAGCAGACAAAGGCTACAACAAGCCATCTTTTCCCCAAGGAA
TAA
Gene >OphauB2|282
ATGCTGCAGCCCGCCGTCGCTCTTGGCGCCGTCCACCATGCCGCTCGCACATTGACGGCCACGATGGAAGCCTCG
ACAACGGCCCTCCAACCATCGTCGGCCCTCGCCATGGCCACCACTACTGGCACTGCCTCTCCCGCTTCTCCCCAT
GATCAAGACTCTCAACAGGGCGAATGTCGTCTGCTCGGTCCTTTTGCCCTCCTCGTCCAGCTGGCTCTTGGCGGT
CTTGCACTCTTGTCGCTCGTGTACAAGCGCTGGCGCGAACGCCCCCAGCGACCTGTCAAGATCTGGTTCTTTGAC
GTCTCTAAACAAGTCTTTGGCTCTGTCCTGGTCCACATTGCCAATGTTTTCATGTCCATGCTTACCAGTGGCCGC
TTCTCCGTGAGCCTCGACTCTGCCGTTCCTGTCGTTGCTGCCAGGTCCGACGACTCTTACCAGCCGAATCCATGC
TCCTTTTACCTTCTCAATCTTGCAATCGATGTCTGTCTCTCCCTCCTGGCTTCTCTTCTGCTCCTTGTCTGTATG
CTAACCAAGACGCAAGACAACCCTTGGCATTCCAATTCTCATTGTACTGCTGCGAGTCATGACAGCCCTCGTAGC
GTTAACCCCTCTCGGTAAGCCTACCGAGTCGATACAGTCGGGCAATTACGGCAGTCCTCCAAACGTATGGTGGTG
GCTCAAACAGTCCGTCATATACTTCTGCGGCCTGTTTGGCATGAAGATATGCGTTCTCATCATCTTCCTCGTTAT
GCCATGGATATCCATGGTTGGTGACTGGGCTCTAGGCTGGACCGAGGGCAATGAGCGCCTGCAAATCGCCTTTGT
CATGATGATTTTCCCTCTTGTCATGAATGCCTTACAGTATTACATCATTGACTCCTTCATCAAGATGAAGGAGCC
CGAGCATCAACGCCTTCCATCCCAAGACCCGGACCAAGACCATGTCGGGCACAGAGAAAGCTCTCGGCTGAGGAG
CCGCATACGAGCTGATCGCGGTAGCGAACACGGTGGTGCCGACGAGCATGGTGACCAGTTATCCAAACTACACCA
CCGGTCTCTCTCCAGCGGCGACGACGAGTACGACCCGGACGTCGACGGCGATGCCCCGACCGTCTTTGGAAGCAG
CAGCTCGAGACGGGGCGTTGAGCAGACAAAGGCTACAACAAGCCATCTTTTCCCCAAGGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail