Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2819
Gene name
LocationContig_193:9230..11378
Strand+
Gene length (bp)2148
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 1.2E-21 48 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 637 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 1 638 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 644 8.0E-165
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 644 2.0E-157
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 648 3.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 637 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 1 638 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 644 8.0E-165
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 644 2.0E-157
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 648 3.0E-156
sp|Q8TFG0|DUR32_SCHPO Probable urea active transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-2 PE=3 SV=1 6 644 1.0E-126
sp|O06493|OPUE_BACSU Osmoregulated proline transporter OpuE OS=Bacillus subtilis (strain 168) GN=opuE PE=1 SV=1 95 505 7.0E-10
sp|Q49B93|SC5AC_MOUSE Sodium-coupled monocarboxylate transporter 2 OS=Mus musculus GN=Slc5a12 PE=1 SV=1 39 266 1.0E-06
sp|P96169|SGLT_VIBPH Sodium/glucose cotransporter OS=Vibrio parahaemolyticus GN=sglT PE=1 SV=2 43 463 2.0E-06
sp|A7MBD8|SC5AC_BOVIN Sodium-coupled monocarboxylate transporter 2 OS=Bos taurus GN=SLC5A12 PE=2 SV=1 44 236 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 55 73 18
3 88 110 22
4 131 153 22
5 163 185 22
6 198 220 22
7 249 271 22
8 284 306 22
9 342 364 22
10 397 419 22
11 429 451 22
12 458 477 19
13 497 519 22
14 568 590 22
15 605 627 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2819
MSSPGPALSQGYGYGIILGVGFAFAVFMISLTHILKRFNNEVQTSEMFNTAGRSVKSGLVASAVVSSWTWAATLL
QSSGVCYRYGVSGPFWYSSGACVQILLFATLAITLKKRAPNAHTFLEAIKARYGAPAHFTFIVFGLVTNVLVSLM
LIAGGAATINALTGVNAVAAIFLMPVPVVAYTFMGGLKATFITDYIHGFAVLIIIMVFALKAYATSHVLGSPSAV
YDLLVDAAQAHPVSGNRDGSYLTMRSSGGITFFVINIVGNFGTVFLDNGYYNKAIAAHPVHALPGYIMGGLAWFA
IPWLTATTLGLSALALESSPRFPTFPNRMSEAEVTAGLALPYGAVALLGKGGAIATLIMIFLAVTSSFNSELVAT
SSIFTYDIYRTYFRPDADGRRLIYMSHVCMVLYAMVICCVSVGLWFTGVSMGYLYLLMGVLISAAVIPAALTLLW
SRQNRWAATLSPVLGTACAIIAWLVTASKTCGRLSVECTGSNNPMLAGNLTALFSPLLFIPILGLIFGFDKYDWK
SMMAIRKADDAVSESGLDPEALAAMDRAKEAEFADEQLKLKRAFRIACVVTLTMALILLVIWPMPLYGTGYIFSK
KFFTGWVAIGIAWIFCSFMAVGLYPAWESRATLFRVVRLIFTGKGGTPVVHGKPGSPQGWSGTVTPVKQEPVYKA
*
Coding >OphauB2|2819
ATGTCGAGTCCCGGACCAGCACTCAGCCAAGGCTATGGCTACGGCATCATTCTGGGCGTGGGCTTTGCCTTTGCC
GTCTTCATGATATCCCTGACGCATATCCTCAAGCGCTTCAACAACGAGGTGCAGACGTCGGAGATGTTCAACACG
GCGGGGCGGAGCGTCAAGTCGGGCCTGGTGGCGTCGGCCGTGGTGTCGTCGTGGACGTGGGCGGCGACGCTGCTG
CAGAGCTCGGGAGTGTGCTACCGCTACGGCGTGTCGGGCCCCTTTTGGTACTCGTCGGGGGCGTGTGTGCAGATT
TTGCTCTTTGCCACGCTGGCCATTACGCTCAAGAAGAGGGCTCCCAATGCGCATACCTTTCTCGAGGCCATCAAG
GCGCGATATGGCGCGCCAGCCCACTTCACCTTTATCGTGTTTGGCCTGGTGACCAATGTGCTCGTGTCGCTCATG
CTCATTGCCGGCGGCGCCGCCACCATTAATGCGCTGACGGGCGTCAATGCCGTTGCCGCCATTTTCCTCATGCCG
GTGCCCGTTGTTGCCTACACCTTTATGGGCGGGCTCAAGGCCACCTTTATCACCGACTACATCCATGGCTTTGCC
GTGCTCATCATCATCATGGTCTTTGCCCTCAAGGCCTATGCTACCTCGCATGTGCTGGGCAGCCCGTCAGCCGTC
TACGACTTGCTCGTCGACGCCGCCCAGGCGCACCCCGTCTCGGGGAACCGTGACGGCAGCTACCTGACGATGCGG
TCGTCGGGCGGCATCACCTTTTTCGTCATCAACATTGTCGGCAACTTTGGCACCGTCTTCCTCGACAATGGCTAC
TACAACAAGGCCATTGCCGCCCATCCCGTCCATGCCCTGCCCGGCTACATCATGGGCGGCCTGGCCTGGTTTGCC
ATTCCCTGGCTGACGGCCACGACGCTCGGGCTCTCGGCTCTCGCTCTGGAGTCGAGCCCGCGCTTCCCCACCTTT
CCTAACCGCATGAGCGAGGCCGAGGTGACGGCCGGCCTGGCCCTGCCCTATGGCGCCGTGGCTCTGCTGGGCAAG
GGCGGCGCCATTGCCACGCTCATCATGATCTTCCTGGCCGTCACCTCCTCCTTCAACTCGGAGCTGGTGGCCACA
TCCTCCATCTTCACCTACGACATCTACCGCACCTACTTTCGCCCCGACGCCGACGGCCGCCGCCTCATCTACATG
TCCCATGTCTGCATGGTGCTCTACGCCATGGTCATTTGCTGCGTCTCCGTCGGCCTCTGGTTCACGGGCGTCTCC
ATGGGCTACCTGTACCTGCTCATGGGCGTCCTCATCTCGGCCGCCGTCATCCCGGCTGCCCTGACGCTGCTGTGG
AGCCGCCAGAACCGCTGGGCCGCCACCTTGTCGCCCGTCCTCGGCACCGCCTGCGCCATTATTGCCTGGCTTGTC
ACGGCCAGCAAGACGTGCGGCCGCCTCAGTGTCGAGTGTACCGGCTCAAACAACCCCATGCTTGCCGGCAACCTC
ACGGCCCTCTTTTCGCCTCTGCTCTTCATCCCCATCCTGGGCCTCATTTTTGGCTTTGACAAGTACGATTGGAAA
TCCATGATGGCTATCCGCAAAGCAGACGACGCCGTCTCTGAGTCTGGCCTCGACCCTGAGGCTCTTGCCGCCATG
GACCGTGCAAAGGAGGCTGAGTTTGCCGACGAGCAGCTCAAGCTCAAGCGTGCCTTTCGCATTGCCTGTGTCGTC
ACTCTTACCATGGCCCTCATTCTCCTGGTTATCTGGCCCATGCCCCTCTACGGCACCGGCTACATCTTTTCCAAA
AAGTTCTTTACCGGTTGGGTCGCCATTGGCATCGCCTGGATCTTTTGCTCCTTTATGGCTGTTGGCTTGTATCCC
GCCTGGGAGAGTCGCGCCACCTTGTTTCGCGTCGTGCGCCTCATATTCACAGGCAAAGGGGGCACGCCCGTGGTG
CATGGCAAACCGGGCTCACCTCAAGGCTGGAGTGGCACCGTCACCCCCGTCAAGCAGGAGCCGGTCTACAAGGCC
TAG
Transcript >OphauB2|2819
ATGTCGAGTCCCGGACCAGCACTCAGCCAAGGCTATGGCTACGGCATCATTCTGGGCGTGGGCTTTGCCTTTGCC
GTCTTCATGATATCCCTGACGCATATCCTCAAGCGCTTCAACAACGAGGTGCAGACGTCGGAGATGTTCAACACG
GCGGGGCGGAGCGTCAAGTCGGGCCTGGTGGCGTCGGCCGTGGTGTCGTCGTGGACGTGGGCGGCGACGCTGCTG
CAGAGCTCGGGAGTGTGCTACCGCTACGGCGTGTCGGGCCCCTTTTGGTACTCGTCGGGGGCGTGTGTGCAGATT
TTGCTCTTTGCCACGCTGGCCATTACGCTCAAGAAGAGGGCTCCCAATGCGCATACCTTTCTCGAGGCCATCAAG
GCGCGATATGGCGCGCCAGCCCACTTCACCTTTATCGTGTTTGGCCTGGTGACCAATGTGCTCGTGTCGCTCATG
CTCATTGCCGGCGGCGCCGCCACCATTAATGCGCTGACGGGCGTCAATGCCGTTGCCGCCATTTTCCTCATGCCG
GTGCCCGTTGTTGCCTACACCTTTATGGGCGGGCTCAAGGCCACCTTTATCACCGACTACATCCATGGCTTTGCC
GTGCTCATCATCATCATGGTCTTTGCCCTCAAGGCCTATGCTACCTCGCATGTGCTGGGCAGCCCGTCAGCCGTC
TACGACTTGCTCGTCGACGCCGCCCAGGCGCACCCCGTCTCGGGGAACCGTGACGGCAGCTACCTGACGATGCGG
TCGTCGGGCGGCATCACCTTTTTCGTCATCAACATTGTCGGCAACTTTGGCACCGTCTTCCTCGACAATGGCTAC
TACAACAAGGCCATTGCCGCCCATCCCGTCCATGCCCTGCCCGGCTACATCATGGGCGGCCTGGCCTGGTTTGCC
ATTCCCTGGCTGACGGCCACGACGCTCGGGCTCTCGGCTCTCGCTCTGGAGTCGAGCCCGCGCTTCCCCACCTTT
CCTAACCGCATGAGCGAGGCCGAGGTGACGGCCGGCCTGGCCCTGCCCTATGGCGCCGTGGCTCTGCTGGGCAAG
GGCGGCGCCATTGCCACGCTCATCATGATCTTCCTGGCCGTCACCTCCTCCTTCAACTCGGAGCTGGTGGCCACA
TCCTCCATCTTCACCTACGACATCTACCGCACCTACTTTCGCCCCGACGCCGACGGCCGCCGCCTCATCTACATG
TCCCATGTCTGCATGGTGCTCTACGCCATGGTCATTTGCTGCGTCTCCGTCGGCCTCTGGTTCACGGGCGTCTCC
ATGGGCTACCTGTACCTGCTCATGGGCGTCCTCATCTCGGCCGCCGTCATCCCGGCTGCCCTGACGCTGCTGTGG
AGCCGCCAGAACCGCTGGGCCGCCACCTTGTCGCCCGTCCTCGGCACCGCCTGCGCCATTATTGCCTGGCTTGTC
ACGGCCAGCAAGACGTGCGGCCGCCTCAGTGTCGAGTGTACCGGCTCAAACAACCCCATGCTTGCCGGCAACCTC
ACGGCCCTCTTTTCGCCTCTGCTCTTCATCCCCATCCTGGGCCTCATTTTTGGCTTTGACAAGTACGATTGGAAA
TCCATGATGGCTATCCGCAAAGCAGACGACGCCGTCTCTGAGTCTGGCCTCGACCCTGAGGCTCTTGCCGCCATG
GACCGTGCAAAGGAGGCTGAGTTTGCCGACGAGCAGCTCAAGCTCAAGCGTGCCTTTCGCATTGCCTGTGTCGTC
ACTCTTACCATGGCCCTCATTCTCCTGGTTATCTGGCCCATGCCCCTCTACGGCACCGGCTACATCTTTTCCAAA
AAGTTCTTTACCGGTTGGGTCGCCATTGGCATCGCCTGGATCTTTTGCTCCTTTATGGCTGTTGGCTTGTATCCC
GCCTGGGAGAGTCGCGCCACCTTGTTTCGCGTCGTGCGCCTCATATTCACAGGCAAAGGGGGCACGCCCGTGGTG
CATGGCAAACCGGGCTCACCTCAAGGCTGGAGTGGCACCGTCACCCCCGTCAAGCAGGAGCCGGTCTACAAGGCC
TAG
Gene >OphauB2|2819
ATGTCGAGTCCCGGACCAGCACTCAGCCAAGGCTATGGCTACGGCATCATTCTGGGCGTGGGCTTTGCCTTTGCC
GTCTTCATGGTAGAGTGCTCGGGGGGGAGGGGGCAATGCCAATGGACTAACCGAGGCGACAGATATCCCTGACGC
ATATCCTCAAGCGCTTCAACAACGAGGTGCAGACGTCGGAGATGTTCAACACGGCGGGGCGGAGCGTCAAGTCGG
GCCTGGTGGCGTCGGCCGTGGTGTCGTCGTGGACGTGGGCGGCGACGCTGCTGCAGAGCTCGGGAGTGTGCTACC
GCTACGGCGTGTCGGGCCCCTTTTGGTACTCGTCGGGGGCGTGTGTGCAGATTTTGCTCTTTGCCACGCTGGCCA
TTACGCTCAAGAAGAGGGCTCCCAATGCGCATACCTTTCTCGAGGCCATCAAGGCGCGATATGGCGCGCCAGCCC
ACTTCACCTTTATCGTGTTTGGCCTGGTGACCAATGTGCTCGTGTCGCTCATGCTCATTGCCGGCGGCGCCGCCA
CCATTAATGCGCTGACGGGCGTCAATGCCGTTGCCGCCATTTTCCTCATGCCGGTGCCCGTTGTTGCCTACACCT
TTATGGGCGGGCTCAAGGCCACCTTTATCACCGACTACATCCATGGCTTTGCCGTGCTCATCATCATCATGGTCT
TTGCCCTCAAGGCCTATGCTACCTCGCATGTGCTGGGCAGCCCGTCAGCCGTCTACGACTTGCTCGTCGACGCCG
CCCAGGCGCACCCCGTCTCGGGGAACCGTGACGGCAGCTACCTGACGATGCGGTCGTCGGGCGGCATCACCTTTT
TCGTCATCAACATTGTCGGCAACTTTGGCACCGTCTTCCTCGACAATGGCTACTACAACAAGGCCATTGCCGCCC
ATCCCGTCCATGCCCTGCCCGGCTACATCATGGGCGGCCTGGCCTGGTTTGCCATTCCCTGGCTGACGGCCACGA
CGCTCGGGCTCTCGGCTCTCGCTCTGGAGTCGAGCCCGCGCTTCCCCACCTTTCCTAACCGCATGAGCGAGGCCG
AGGTGACGGCCGGCCTGGCCCTGCCCTATGGCGCCGTGGCTCTGCTGGGCAAGGGCGGCGCCATTGCCACGCTCA
TCATGATCTTCCTGGCCGTCACCTCCTCCTTCAACTCGGAGCTGGTGGCCACATCCTCCATCTTCACCTACGACA
TCTACCGCACCTACTTTCGCCCCGACGCCGACGGCCGCCGCCTCATCTACATGTCCCATGTCTGCATGGTGCTCT
ACGCCATGGTCATTTGCTGCGTCTCCGTCGGCCTCTGGTTCACGGGCGTCTCCATGGGCTACCTGTACCTGCTCA
TGGGCGTCCTCATCTCGGCCGCCGTCATCCCGGCTGCCCTGACGCTGCTGTGGAGCCGCCAGAACCGCTGGGCCG
CCACCTTGTCGCCCGTCCTCGGCACCGCCTGCGCCATTATTGCCTGGCTTGTCACGGCCAGCAAGACGTGCGGCC
GCCTCAGTGTCGAGTGTACCGGCTCAAACAACCCCATGCTTGCCGGCAACCTCACGGCCCTCTTTTCGCCTCTGC
TCTTCATCCCCATCCTGGGCCTCATTTTTGGCTTTGACAAGTACGATTGGAAATCCATGATGGCTATCCGCAAAG
CAGACGACGCCGTCTCTGAGTCTGGCCTCGACCCTGAGGCTCTTGCCGCCATGGACCGTGCAAAGGAGGCTGAGT
TTGCCGACGAGCAGCTCAAGCTCAAGCGTGCCTTTCGCATTGCCTGTGTCGTCACTCTTACCATGTCGGTGGCCA
GTCTTTTGTCGTGGTCCATCTCCCCGTCAAGCCCTGCTGACCCTCGTTTGCTACAGGGCCCTCATTCTCCTGGTT
ATCTGGCCCATGCCCCTCTACGGCACCGGCTACATCTTTTCCAAAAAGTTCTTTACCGGTTGGGTCGCCATTGGC
ATCGCCTGGATCTTTTGCTCCTTTATGGCTGTTGGCTTGTATCCCGCCTGGGAGAGTCGCGCCACCTTGTTTCGC
GTCGTGCGCCTCATATTCACAGGCAAAGGGGGCACGCCCGTGGTGCATGGCAAACCGGGCTCACCTCAAGGCTGG
AGTGGCACCGTCACCCCCGTCAAGCAGGAGCCGGTCTACAAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail