Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2813
Gene name
LocationContig_192:25262..28916
Strand+
Gene length (bp)3654
Transcript length (bp)3654
Coding sequence length (bp)3654
Protein length (aa) 1218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 2.3E-22 945 1033
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 5.8E-22 1091 1166
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-13 754 883
PF00575 S1 S1 RNA binding domain 4.3E-10 255 321
PF00270 DEAD DEAD/DEAH box helicase 8.9E-06 560 710

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 23 1209 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 222 1202 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 207 1205 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 256 1202 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 252 1205 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 23 1209 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 222 1202 0.0E+00
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 207 1205 0.0E+00
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 256 1202 0.0E+00
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 252 1205 0.0E+00
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 250 1207 0.0E+00
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 544 1170 0.0E+00
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 545 1170 0.0E+00
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 545 1170 0.0E+00
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 545 1170 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 539 1170 0.0E+00
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 383 1175 0.0E+00
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 382 1189 0.0E+00
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 547 1187 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 534 1171 0.0E+00
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 382 1181 0.0E+00
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 382 1181 0.0E+00
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 377 1171 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 533 1171 0.0E+00
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 541 1179 0.0E+00
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 546 1186 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 546 1186 0.0E+00
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 546 1187 0.0E+00
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 546 1186 0.0E+00
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 546 1186 0.0E+00
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 546 1186 0.0E+00
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 544 1190 0.0E+00
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 535 1210 0.0E+00
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 521 1190 0.0E+00
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 546 1171 0.0E+00
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 544 1182 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 544 1170 0.0E+00
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 508 1181 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 545 1170 0.0E+00
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 533 1172 0.0E+00
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 533 1170 0.0E+00
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 533 1170 0.0E+00
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 546 1169 0.0E+00
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 553 1161 0.0E+00
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 553 1181 5.0E-174
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 553 1181 8.0E-174
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 553 1175 2.0E-173
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 553 1181 3.0E-173
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 543 1181 6.0E-170
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 646 1077 1.0E-167
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 535 1161 1.0E-146
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 481 1172 8.0E-143
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 551 1183 2.0E-124
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 522 1083 1.0E-114
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 522 1090 2.0E-114
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 553 1170 5.0E-114
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 553 1198 3.0E-113
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 546 1165 3.0E-111
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 548 1169 8.0E-110
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 499 1169 7.0E-108
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 553 1168 1.0E-107
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 548 1169 2.0E-101
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 546 1169 5.0E-93
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 546 1169 9.0E-86
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 546 1169 4.0E-83
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 550 1041 7.0E-76
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 548 1070 2.0E-74
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 546 1041 5.0E-74
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 546 1041 9.0E-74
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 546 1041 1.0E-73
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 546 1041 2.0E-73
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 546 1041 3.0E-73
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 548 1041 1.0E-72
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 548 1067 1.0E-72
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 536 1187 4.0E-71
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 545 1134 2.0E-70
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 552 1088 2.0E-65
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 553 984 2.0E-65
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 537 1041 5.0E-65
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 537 1041 4.0E-61
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 536 1060 5.0E-61
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 553 1014 1.0E-59
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 554 1050 7.0E-59
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 553 1070 4.0E-57
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 553 1037 6.0E-57
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 537 1070 7.0E-57
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 537 1070 7.0E-57
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 741 1162 2.0E-56
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 741 1162 5.0E-56
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 745 1156 1.0E-55
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 794 1168 1.0E-55
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 553 1006 4.0E-55
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 553 1006 6.0E-55
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 532 1040 8.0E-55
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 795 1168 9.0E-53
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 553 1006 2.0E-52
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 553 1006 5.0E-52
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 553 1002 5.0E-52
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 553 1006 2.0E-51
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 743 1158 3.0E-51
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 553 1100 3.0E-51
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 546 788 2.0E-50
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 553 1064 2.0E-50
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 546 781 3.0E-50
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 546 774 7.0E-50
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 743 1100 2.0E-49
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 760 1074 3.0E-48
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 760 1150 9.0E-48
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 531 794 2.0E-46
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 546 791 6.0E-46
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 795 1196 2.0E-45
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 736 1129 2.0E-45
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 743 1156 2.0E-45
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 736 1129 2.0E-45
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 749 1114 3.0E-45
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 795 1144 2.0E-44
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 550 736 2.0E-44
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 761 1158 7.0E-44
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 539 736 4.0E-43
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 762 1130 5.0E-43
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 545 736 1.0E-42
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 761 1158 2.0E-42
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 761 1158 2.0E-42
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 544 956 3.0E-41
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 550 755 7.0E-41
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 548 736 7.0E-41
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 539 736 1.0E-40
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 548 736 1.0E-40
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 545 732 4.0E-40
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 762 1130 5.0E-40
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 540 736 3.0E-39
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 540 736 3.0E-39
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 553 1009 5.0E-39
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 795 1176 2.0E-38
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 546 736 5.0E-37
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 544 732 2.0E-36
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 544 732 3.0E-36
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 545 733 3.0E-36
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 545 733 5.0E-36
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 545 733 5.0E-36
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 546 736 6.0E-35
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 534 736 1.0E-34
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 762 1040 2.0E-34
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 499 739 3.0E-34
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 569 971 5.0E-34
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 569 963 1.0E-33
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 569 971 1.0E-33
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 569 963 1.0E-33
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 762 1040 2.0E-33
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 762 1040 2.0E-33
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 569 963 2.0E-33
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 762 1074 2.0E-33
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 545 733 3.0E-33
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 546 736 3.0E-33
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 762 1040 4.0E-33
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 546 736 1.0E-28
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 762 1075 2.0E-26
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 568 892 3.0E-25
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 900 1129 5.0E-17
sp|Q5LN23|PNP_RUEPO Polyribonucleotide nucleotidyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pnp PE=3 SV=1 258 343 3.0E-15
sp|A1B5P9|PNP_PARDP Polyribonucleotide nucleotidyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=pnp PE=3 SV=2 258 346 1.0E-14
sp|A8LKE7|PNP_DINSH Polyribonucleotide nucleotidyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pnp PE=3 SV=1 258 342 1.0E-14
sp|Q28K17|PNP_JANSC Polyribonucleotide nucleotidyltransferase OS=Jannaschia sp. (strain CCS1) GN=pnp PE=3 SV=1 258 335 2.0E-14
sp|Q1GKK5|PNP_RUEST Polyribonucleotide nucleotidyltransferase OS=Ruegeria sp. (strain TM1040) GN=pnp PE=3 SV=1 259 343 3.0E-14
sp|Q16CF6|PNP_ROSDO Polyribonucleotide nucleotidyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pnp PE=3 SV=1 259 341 5.0E-14
sp|B9KP47|PNP_RHOSK Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pnp PE=3 SV=1 258 343 2.0E-13
sp|Q2G5F5|PNP_NOVAD Polyribonucleotide nucleotidyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pnp PE=3 SV=1 256 339 2.0E-13
sp|Q5NQ32|PNP_ZYMMO Polyribonucleotide nucleotidyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pnp PE=3 SV=1 254 339 3.0E-13
sp|Q0AK62|PNP_MARMM Polyribonucleotide nucleotidyltransferase OS=Maricaulis maris (strain MCS10) GN=pnp PE=3 SV=1 258 341 3.0E-13
sp|A4WWP0|PNP_RHOS5 Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pnp PE=3 SV=2 258 343 4.0E-13
sp|Q2NBZ2|PNP_ERYLH Polyribonucleotide nucleotidyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=pnp PE=3 SV=1 256 339 1.0E-12
sp|Q3IYT7|PNP_RHOS4 Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pnp PE=3 SV=1 258 340 1.0E-12
sp|A3PNG0|PNP_RHOS1 Polyribonucleotide nucleotidyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pnp PE=3 SV=1 258 340 1.0E-12
sp|A6VU33|PNP_MARMS Polyribonucleotide nucleotidyltransferase OS=Marinomonas sp. (strain MWYL1) GN=pnp PE=3 SV=1 256 333 2.0E-12
sp|B8EP09|PNP_METSB Polyribonucleotide nucleotidyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=pnp PE=3 SV=1 254 343 8.0E-12
sp|Q9AC32|PNP_CAUCR Polyribonucleotide nucleotidyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pnp PE=1 SV=1 231 338 1.0E-11
sp|B8GWZ0|PNP_CAUCN Polyribonucleotide nucleotidyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pnp PE=3 SV=1 231 338 1.0E-11
sp|A5VCY9|PNP_SPHWW Polyribonucleotide nucleotidyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=pnp PE=3 SV=1 254 343 1.0E-11
sp|Q0BWM9|PNP_HYPNA Polyribonucleotide nucleotidyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pnp PE=3 SV=1 256 342 2.0E-11
sp|Q21C27|PNP_RHOPB Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=pnp PE=3 SV=1 254 350 2.0E-11
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 743 1129 3.0E-11
sp|Q1GVQ8|PNP_SPHAL Polyribonucleotide nucleotidyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pnp PE=3 SV=1 256 339 5.0E-11
sp|B4RC48|PNP_PHEZH Polyribonucleotide nucleotidyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=pnp PE=3 SV=1 254 338 6.0E-11
sp|A5E870|PNP_BRASB Polyribonucleotide nucleotidyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pnp PE=3 SV=1 254 369 7.0E-11
sp|Q3SWP5|PNP_NITWN Polyribonucleotide nucleotidyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pnp PE=3 SV=1 254 354 8.0E-11
sp|B0T175|PNP_CAUSK Polyribonucleotide nucleotidyltransferase OS=Caulobacter sp. (strain K31) GN=pnp PE=3 SV=1 256 345 1.0E-10
sp|B2ICY4|PNP_BEII9 Polyribonucleotide nucleotidyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=pnp PE=3 SV=1 254 339 1.0E-10
sp|Q13EM2|PNP_RHOPS Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=pnp PE=3 SV=1 254 351 1.0E-10
sp|B3QAB0|PNP_RHOPT Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=pnp PE=3 SV=1 254 351 2.0E-10
sp|B3PIA0|PNP_CELJU Polyribonucleotide nucleotidyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=pnp PE=3 SV=1 232 335 2.0E-10
sp|Q7VL91|PNP_HAEDU Polyribonucleotide nucleotidyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pnp PE=3 SV=1 256 342 2.0E-10
sp|Q2J2J4|PNP_RHOP2 Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=pnp PE=3 SV=1 254 354 2.0E-10
sp|Q6NCN8|PNP_RHOPA Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pnp PE=3 SV=1 254 351 2.0E-10
sp|A7IC03|PNP_XANP2 Polyribonucleotide nucleotidyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pnp PE=3 SV=1 254 339 2.0E-10
sp|Q2SMK9|PNP_HAHCH Polyribonucleotide nucleotidyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=pnp PE=3 SV=1 256 333 2.0E-10
sp|Q1QS60|PNP_NITHX Polyribonucleotide nucleotidyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pnp PE=3 SV=2 254 369 4.0E-10
sp|Q8FXS9|PNP_BRUSU Polyribonucleotide nucleotidyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|Q8YEB7|PNP_BRUME Polyribonucleotide nucleotidyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|C0RG51|PNP_BRUMB Polyribonucleotide nucleotidyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|Q1QSZ4|PNP_CHRSD Polyribonucleotide nucleotidyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pnp PE=3 SV=1 232 333 5.0E-10
sp|A9IMR9|PNP_BART1 Polyribonucleotide nucleotidyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pnp PE=3 SV=1 252 338 5.0E-10
sp|B0CK15|PNP_BRUSI Polyribonucleotide nucleotidyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|A9M9Z8|PNP_BRUC2 Polyribonucleotide nucleotidyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|Q57A96|PNP_BRUAB Polyribonucleotide nucleotidyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|Q2YQR3|PNP_BRUA2 Polyribonucleotide nucleotidyltransferase OS=Brucella abortus (strain 2308) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|B2S9G0|PNP_BRUA1 Polyribonucleotide nucleotidyltransferase OS=Brucella abortus (strain S19) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|A5VTB6|PNP_BRUO2 Polyribonucleotide nucleotidyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pnp PE=3 SV=1 254 343 5.0E-10
sp|A1U5Z6|PNP_MARHV Polyribonucleotide nucleotidyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pnp PE=3 SV=1 256 332 6.0E-10
sp|Q89WB3|PNP_BRADU Polyribonucleotide nucleotidyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pnp PE=3 SV=1 254 369 6.0E-10
sp|Q21H65|PNP_SACD2 Polyribonucleotide nucleotidyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pnp PE=3 SV=1 232 330 6.0E-10
sp|Q5FQL9|PNP_GLUOX Polyribonucleotide nucleotidyltransferase OS=Gluconobacter oxydans (strain 621H) GN=pnp PE=3 SV=1 254 338 6.0E-10
sp|A6WWW1|PNP_OCHA4 Polyribonucleotide nucleotidyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pnp PE=3 SV=1 254 343 6.0E-10
sp|C5BPV5|PNP_TERTT Polyribonucleotide nucleotidyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=pnp PE=3 SV=1 232 330 8.0E-10
sp|B6JCR8|PNP_OLICO Polyribonucleotide nucleotidyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pnp PE=3 SV=1 254 343 9.0E-10
sp|Q9CLU1|PNP_PASMU Polyribonucleotide nucleotidyltransferase OS=Pasteurella multocida (strain Pm70) GN=pnp PE=3 SV=1 259 330 1.0E-09
sp|Q2KE00|PNP_RHIEC Polyribonucleotide nucleotidyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pnp PE=3 SV=1 254 343 1.0E-09
sp|B0UTJ5|PNP_HISS2 Polyribonucleotide nucleotidyltransferase OS=Histophilus somni (strain 2336) GN=pnp PE=3 SV=1 259 333 1.0E-09
sp|Q0I2T0|PNP_HAES1 Polyribonucleotide nucleotidyltransferase OS=Haemophilus somnus (strain 129Pt) GN=pnp PE=3 SV=1 259 333 1.0E-09
sp|Q7VQM0|PNP_BLOFL Polyribonucleotide nucleotidyltransferase OS=Blochmannia floridanus GN=pnp PE=3 SV=1 256 332 1.0E-09
sp|B3PXD7|PNP_RHIE6 Polyribonucleotide nucleotidyltransferase OS=Rhizobium etli (strain CIAT 652) GN=pnp PE=3 SV=2 254 343 2.0E-09
sp|Q0BPK3|PNP_GRABC Polyribonucleotide nucleotidyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pnp PE=3 SV=1 254 338 2.0E-09
sp|A6UF34|PNP_SINMW Polyribonucleotide nucleotidyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=pnp PE=3 SV=1 254 343 2.0E-09
sp|Q1MN44|PNP_RHIL3 Polyribonucleotide nucleotidyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pnp PE=3 SV=1 254 343 2.0E-09
sp|Q07V82|PNP_RHOP5 Polyribonucleotide nucleotidyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=pnp PE=3 SV=1 254 338 2.0E-09
sp|Q9Q927|NPH2_RFVKA RNA helicase NPH-II OS=Rabbit fibroma virus (strain Kasza) GN=NPH2 PE=2 SV=1 572 964 2.0E-09
sp|A9W8P8|PNP_METEP Polyribonucleotide nucleotidyltransferase OS=Methylobacterium extorquens (strain PA1) GN=pnp PE=3 SV=2 259 338 2.0E-09
sp|B7KN55|PNP_METC4 Polyribonucleotide nucleotidyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=pnp PE=3 SV=1 259 338 2.0E-09
sp|O72904|NPH2_FOWPN RNA helicase NPH-II OS=Fowlpox virus (strain NVSL) GN=NPH2 PE=3 SV=1 472 929 2.0E-09
sp|A8IGA3|PNP_AZOC5 Polyribonucleotide nucleotidyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pnp PE=3 SV=2 254 351 2.0E-09
sp|B5ZW24|PNP_RHILW Polyribonucleotide nucleotidyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pnp PE=3 SV=1 254 343 2.0E-09
sp|A4YJF3|PNP_BRASO Polyribonucleotide nucleotidyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pnp PE=3 SV=1 254 343 2.0E-09
sp|A9HF35|PNP_GLUDA Polyribonucleotide nucleotidyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=pnp PE=3 SV=1 254 338 3.0E-09
sp|B8F492|PNP_HAEPS Polyribonucleotide nucleotidyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pnp PE=3 SV=1 256 334 3.0E-09
sp|A4VPN6|PNP_PSEU5 Polyribonucleotide nucleotidyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=pnp PE=3 SV=1 256 330 3.0E-09
sp|A5FVG2|PNP_ACICJ Polyribonucleotide nucleotidyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=pnp PE=3 SV=1 254 338 4.0E-09
sp|Q11BC3|PNP_CHESB Polyribonucleotide nucleotidyltransferase OS=Chelativorans sp. (strain BNC1) GN=pnp PE=3 SV=1 254 338 4.0E-09
sp|B0BUD5|PNP_ACTPJ Polyribonucleotide nucleotidyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pnp PE=3 SV=1 256 333 4.0E-09
sp|B3GXC1|PNP_ACTP7 Polyribonucleotide nucleotidyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pnp PE=3 SV=2 256 333 4.0E-09
sp|A3MZU3|PNP_ACTP2 Polyribonucleotide nucleotidyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pnp PE=3 SV=1 256 333 4.0E-09
sp|B6IVG3|PNP_RHOCS Polyribonucleotide nucleotidyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pnp PE=3 SV=1 254 338 4.0E-09
sp|C1DFK5|PNP_AZOVD Polyribonucleotide nucleotidyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pnp PE=3 SV=1 256 330 4.0E-09
sp|O06000|RS1H_BACC1 30S ribosomal protein S1 homolog OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_1625 PE=3 SV=1 259 328 4.0E-09
sp|B4F2C3|PNP_PROMH Polyribonucleotide nucleotidyltransferase OS=Proteus mirabilis (strain HI4320) GN=pnp PE=3 SV=1 256 329 4.0E-09
sp|B1Y823|PNP_LEPCP Polyribonucleotide nucleotidyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pnp PE=3 SV=1 256 339 4.0E-09
sp|Q9Q8Q2|NPH2_MYXVL RNA helicase NPH-II OS=Myxoma virus (strain Lausanne) GN=NPH2 PE=3 SV=1 572 964 5.0E-09
sp|Q3IJ73|PNP_PSEHT Polyribonucleotide nucleotidyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pnp PE=1 SV=1 256 329 5.0E-09
sp|A2SFM2|PNP_METPP Polyribonucleotide nucleotidyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=pnp PE=3 SV=1 256 328 6.0E-09
sp|Q127W8|PNP_POLSJ Polyribonucleotide nucleotidyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pnp PE=3 SV=1 256 328 6.0E-09
sp|A1WXU7|PNP_HALHL Polyribonucleotide nucleotidyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pnp PE=3 SV=1 256 333 6.0E-09
sp|C5BFC1|PNP_EDWI9 Polyribonucleotide nucleotidyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=pnp PE=3 SV=1 256 334 7.0E-09
sp|B1ZGS7|PNP_METPB Polyribonucleotide nucleotidyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pnp PE=3 SV=1 259 338 7.0E-09
sp|C5CT24|PNP_VARPS Polyribonucleotide nucleotidyltransferase OS=Variovorax paradoxus (strain S110) GN=pnp PE=3 SV=1 256 337 7.0E-09
sp|A1UU54|PNP_BARBK Polyribonucleotide nucleotidyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pnp PE=3 SV=1 252 338 7.0E-09
sp|A6VCJ6|PNP_PSEA7 Polyribonucleotide nucleotidyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=pnp PE=3 SV=1 256 330 8.0E-09
sp|Q98BI3|PNP_RHILO Polyribonucleotide nucleotidyltransferase OS=Rhizobium loti (strain MAFF303099) GN=pnp PE=3 SV=1 254 343 8.0E-09
sp|Q9HV59|PNP_PSEAE Polyribonucleotide nucleotidyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pnp PE=3 SV=1 256 330 8.0E-09
sp|Q02FT2|PNP_PSEAB Polyribonucleotide nucleotidyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pnp PE=3 SV=1 256 330 8.0E-09
sp|B7V1F2|PNP_PSEA8 Polyribonucleotide nucleotidyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=pnp PE=3 SV=1 256 330 8.0E-09
sp|Q2RMR6|PNP_RHORT Polyribonucleotide nucleotidyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pnp PE=3 SV=1 254 342 9.0E-09
sp|A5WBT2|PNP_PSYWF Polyribonucleotide nucleotidyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=pnp PE=3 SV=1 256 333 9.0E-09
sp|Q9ESX4|NO40_MOUSE Nucleolar protein of 40 kDa OS=Mus musculus GN=Zcchc17 PE=1 SV=1 242 342 9.0E-09
sp|Q9NP64|NO40_HUMAN Nucleolar protein of 40 kDa OS=Homo sapiens GN=ZCCHC17 PE=1 SV=1 242 342 9.0E-09
sp|Q482T5|PNP_COLP3 Polyribonucleotide nucleotidyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pnp PE=3 SV=1 256 329 1.0E-08
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 18 156 1.0E-08
sp|A1VM56|PNP_POLNA Polyribonucleotide nucleotidyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pnp PE=3 SV=1 256 328 1.0E-08
sp|Q6G5F8|PNP_BARHE Polyribonucleotide nucleotidyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pnp PE=3 SV=1 252 338 1.0E-08
sp|A7HZ97|PNP_PARL1 Polyribonucleotide nucleotidyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pnp PE=3 SV=1 254 335 1.0E-08
sp|Q6D9A1|PNP_PECAS Polyribonucleotide nucleotidyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pnp PE=3 SV=1 256 334 2.0E-08
sp|Q21YD1|PNP_RHOFT Polyribonucleotide nucleotidyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pnp PE=3 SV=1 256 328 2.0E-08
sp|A4XYD6|PNP_PSEMY Polyribonucleotide nucleotidyltransferase OS=Pseudomonas mendocina (strain ymp) GN=pnp PE=3 SV=2 256 330 2.0E-08
sp|Q6G0P7|PNP_BARQU Polyribonucleotide nucleotidyltransferase OS=Bartonella quintana (strain Toulouse) GN=pnp PE=3 SV=1 252 350 2.0E-08
sp|C6DKK7|PNP_PECCP Polyribonucleotide nucleotidyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pnp PE=3 SV=1 256 329 2.0E-08
sp|Q0A7A1|PNP_ALKEH Polyribonucleotide nucleotidyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pnp PE=3 SV=2 237 330 2.0E-08
sp|Q2VZQ4|PNP_MAGSA Polyribonucleotide nucleotidyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pnp PE=3 SV=1 254 341 2.0E-08
sp|A8G911|PNP_SERP5 Polyribonucleotide nucleotidyltransferase OS=Serratia proteamaculans (strain 568) GN=pnp PE=3 SV=1 256 335 3.0E-08
sp|B2VGN7|PNP_ERWT9 Polyribonucleotide nucleotidyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pnp PE=3 SV=1 256 334 3.0E-08
sp|B7LR33|PNP_ESCF3 Polyribonucleotide nucleotidyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|Q1R6H4|PNP_ECOUT Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|B1LFR6|PNP_ECOSM Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pnp PE=3 SV=1 256 334 4.0E-08
sp|B7NDF0|PNP_ECOLU Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|Q8FD87|PNP_ECOL6 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|Q0TCU5|PNP_ECOL5 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|A1AG69|PNP_ECOK1 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O1:K1 / APEC GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|B7N0U9|PNP_ECO81 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|B7MB85|PNP_ECO45 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pnp PE=3 SV=2 256 334 4.0E-08
sp|A1WLP8|PNP_VEREI Polyribonucleotide nucleotidyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pnp PE=3 SV=1 256 348 4.0E-08
sp|Q4FVL0|PNP_PSYA2 Polyribonucleotide nucleotidyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pnp PE=3 SV=1 256 332 4.0E-08
sp|Q31W43|PNP_SHIBS Polyribonucleotide nucleotidyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|C1F8M1|PNP_ACIC5 Polyribonucleotide nucleotidyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=pnp PE=3 SV=1 254 333 5.0E-08
sp|A1AWB1|PNP_RUTMC Polyribonucleotide nucleotidyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=pnp PE=3 SV=1 249 328 5.0E-08
sp|Q83JG0|PNP_SHIFL Polyribonucleotide nucleotidyltransferase OS=Shigella flexneri GN=pnp PE=3 SV=5 256 334 5.0E-08
sp|Q0T0B7|PNP_SHIF8 Polyribonucleotide nucleotidyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|Q6FF12|PNP_ACIAD Polyribonucleotide nucleotidyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pnp PE=3 SV=1 258 332 5.0E-08
sp|B9JYL0|PNP_AGRVS Polyribonucleotide nucleotidyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pnp PE=3 SV=1 254 351 5.0E-08
sp|P05055|PNP_ECOLI Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain K12) GN=pnp PE=1 SV=3 256 334 5.0E-08
sp|A8A4Y0|PNP_ECOHS Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|B1XGX6|PNP_ECODH Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|C4ZSQ5|PNP_ECOBW Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|Q3YX77|PNP_SHISS Polyribonucleotide nucleotidyltransferase OS=Shigella sonnei (strain Ss046) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|B2U211|PNP_SHIB3 Polyribonucleotide nucleotidyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|B6I1N9|PNP_ECOSE Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain SE11) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|B7NKN3|PNP_ECO7I Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|B5YS54|PNP_ECO5E Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|Q8X9M3|PNP_ECO57 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O157:H7 GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|B7LH99|PNP_ECO55 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|A7ZS61|PNP_ECO24 Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|B7M072|PNP_ECO8A Polyribonucleotide nucleotidyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pnp PE=3 SV=2 256 334 5.0E-08
sp|B6J6S7|PNP_COXB1 Polyribonucleotide nucleotidyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=pnp PE=3 SV=1 256 331 5.0E-08
sp|Q4FNM6|PNP_PELUB Polyribonucleotide nucleotidyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=pnp PE=3 SV=1 256 328 5.0E-08
sp|B1IQV7|PNP_ECOLC Polyribonucleotide nucleotidyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pnp PE=3 SV=1 256 334 5.0E-08
sp|B6J0K5|PNP_COXB2 Polyribonucleotide nucleotidyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=pnp PE=3 SV=1 256 331 5.0E-08
sp|A1ST53|PNP_PSYIN Polyribonucleotide nucleotidyltransferase OS=Psychromonas ingrahamii (strain 37) GN=pnp PE=3 SV=1 256 329 6.0E-08
sp|Q83D87|PNP_COXBU Polyribonucleotide nucleotidyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pnp PE=1 SV=1 256 331 6.0E-08
sp|A9ND62|PNP_COXBR Polyribonucleotide nucleotidyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pnp PE=3 SV=1 256 331 6.0E-08
sp|A9KFK6|PNP_COXBN Polyribonucleotide nucleotidyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pnp PE=3 SV=1 256 331 6.0E-08
sp|Q8ZLT3|PNP_SALTY Polyribonucleotide nucleotidyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pnp PE=1 SV=1 256 334 8.0E-08
sp|B5BGJ1|PNP_SALPK Polyribonucleotide nucleotidyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pnp PE=3 SV=1 256 334 8.0E-08
sp|C0PZ50|PNP_SALPC Polyribonucleotide nucleotidyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pnp PE=3 SV=2 256 334 8.0E-08
sp|A9N728|PNP_SALPB Polyribonucleotide nucleotidyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pnp PE=3 SV=2 256 334 8.0E-08
sp|Q5PL97|PNP_SALPA Polyribonucleotide nucleotidyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pnp PE=3 SV=1 256 334 8.0E-08
sp|B5REN2|PNP_SALG2 Polyribonucleotide nucleotidyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pnp PE=3 SV=1 256 334 8.0E-08
sp|B5QZV4|PNP_SALEP Polyribonucleotide nucleotidyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pnp PE=3 SV=1 256 334 8.0E-08
sp|Q57JI3|PNP_SALCH Polyribonucleotide nucleotidyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pnp PE=3 SV=2 256 334 8.0E-08
sp|Q5QYE1|PNP_IDILO Polyribonucleotide nucleotidyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pnp PE=3 SV=1 256 327 8.0E-08
sp|A8AQ53|PNP_CITK8 Polyribonucleotide nucleotidyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pnp PE=3 SV=2 256 334 9.0E-08
sp|B9MEL0|PNP_ACIET Polyribonucleotide nucleotidyltransferase OS=Acidovorax ebreus (strain TPSY) GN=pnp PE=3 SV=1 256 335 1.0E-07
sp|Q1IQ54|PNP_KORVE Polyribonucleotide nucleotidyltransferase OS=Koribacter versatilis (strain Ellin345) GN=pnp PE=3 SV=1 256 333 1.0E-07
sp|A6TEI3|PNP_KLEP7 Polyribonucleotide nucleotidyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pnp PE=3 SV=1 256 333 1.0E-07
sp|B0VLR7|PNP_ACIBS Polyribonucleotide nucleotidyltransferase OS=Acinetobacter baumannii (strain SDF) GN=pnp PE=3 SV=1 258 332 1.0E-07
sp|Q2GJV5|PNP_ANAPZ Polyribonucleotide nucleotidyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=pnp PE=3 SV=1 254 369 1.0E-07
sp|B5XSX9|PNP_KLEP3 Polyribonucleotide nucleotidyltransferase OS=Klebsiella pneumoniae (strain 342) GN=pnp PE=3 SV=1 256 333 1.0E-07
sp|A4SJR9|PNP_AERS4 Polyribonucleotide nucleotidyltransferase OS=Aeromonas salmonicida (strain A449) GN=pnp PE=3 SV=1 256 331 1.0E-07
sp|B0UEX5|PNP_METS4 Polyribonucleotide nucleotidyltransferase OS=Methylobacterium sp. (strain 4-46) GN=pnp PE=3 SV=1 259 338 1.0E-07
sp|A1W4L8|PNP_ACISJ Polyribonucleotide nucleotidyltransferase OS=Acidovorax sp. (strain JS42) GN=pnp PE=3 SV=1 256 335 1.0E-07
sp|P14129|RS1_RHIME 30S ribosomal protein S1 OS=Rhizobium meliloti (strain 1021) GN=rpsA PE=3 SV=2 258 333 2.0E-07
sp|A5N848|PNP_CLOK5 Polyribonucleotide nucleotidyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pnp PE=3 SV=1 255 329 2.0E-07
sp|B9E1K8|PNP_CLOK1 Polyribonucleotide nucleotidyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=pnp PE=3 SV=2 255 329 2.0E-07
sp|Q6NDP1|RS1_RHOPA 30S ribosomal protein S1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsA PE=1 SV=1 258 328 2.0E-07
sp|B1LZQ1|PNP_METRJ Polyribonucleotide nucleotidyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=pnp PE=3 SV=1 254 338 2.0E-07
sp|A9BNB8|PNP_DELAS Polyribonucleotide nucleotidyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=pnp PE=3 SV=1 256 328 2.0E-07
sp|Q3J9C0|PNP_NITOC Polyribonucleotide nucleotidyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pnp PE=3 SV=1 256 333 2.0E-07
sp|Q83E09|RS1_COXBU 30S ribosomal protein S1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsA PE=1 SV=1 261 328 3.0E-07
sp|B2U7R6|PNP_RALPJ Polyribonucleotide nucleotidyltransferase OS=Ralstonia pickettii (strain 12J) GN=pnp PE=3 SV=1 256 335 3.0E-07
sp|A0LE14|PNP_MAGMM Polyribonucleotide nucleotidyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=pnp PE=3 SV=1 258 334 3.0E-07
sp|Q47D98|PNP_DECAR Polyribonucleotide nucleotidyltransferase OS=Dechloromonas aromatica (strain RCB) GN=pnp PE=3 SV=1 256 340 3.0E-07
sp|Q8XXP6|PNP_RALSO Polyribonucleotide nucleotidyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=pnp PE=3 SV=1 256 335 3.0E-07
sp|P50889|RS1_LEULA 30S ribosomal protein S1 OS=Leuconostoc lactis GN=rps1 PE=2 SV=2 246 333 3.0E-07
sp|P38494|RS1H_BACSU 30S ribosomal protein S1 homolog OS=Bacillus subtilis (strain 168) GN=ypfD PE=1 SV=1 256 329 3.0E-07
sp|Q92HM4|RS1_RICCN 30S ribosomal protein S1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsA PE=3 SV=1 259 331 3.0E-07
sp|A0KND9|PNP_AERHH Polyribonucleotide nucleotidyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pnp PE=3 SV=1 256 331 4.0E-07
sp|B8IGX3|PNP_METNO Polyribonucleotide nucleotidyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=pnp PE=3 SV=1 259 338 4.0E-07
sp|Q98218|NPH2_MCV1 RNA helicase NPH-II OS=Molluscum contagiosum virus subtype 1 GN=NPH2 PE=3 SV=1 667 894 4.0E-07
sp|C4L8X0|PNP_TOLAT Polyribonucleotide nucleotidyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pnp PE=3 SV=1 256 329 5.0E-07
sp|Q4ULF1|RS1_RICFE 30S ribosomal protein S1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsA PE=3 SV=1 259 331 5.0E-07
sp|A5EXU0|PNP_DICNV Polyribonucleotide nucleotidyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=pnp PE=3 SV=1 249 329 6.0E-07
sp|Q1GXD2|PNP_METFK Polyribonucleotide nucleotidyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pnp PE=3 SV=1 256 328 6.0E-07
sp|Q9ZD28|RS1_RICPR 30S ribosomal protein S1 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsA PE=3 SV=1 259 331 8.0E-07
sp|Q1RJH1|RS1_RICBR 30S ribosomal protein S1 OS=Rickettsia bellii (strain RML369-C) GN=rpsA PE=3 SV=1 259 331 8.0E-07
sp|Q2NW19|PNP_SODGM Polyribonucleotide nucleotidyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pnp PE=3 SV=1 256 329 9.0E-07
sp|B9KIE3|PNP_ANAMF Polyribonucleotide nucleotidyltransferase OS=Anaplasma marginale (strain Florida) GN=pnp PE=3 SV=1 254 354 1.0E-06
sp|Q5L0I2|PNP_GEOKA Polyribonucleotide nucleotidyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=pnp PE=3 SV=1 256 351 1.0E-06
sp|Q68WL4|RS1_RICTY 30S ribosomal protein S1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsA PE=3 SV=1 259 331 1.0E-06
sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic virus PE=3 SV=2 572 890 1.0E-06
sp|A7H9F8|PNP_ANADF Polyribonucleotide nucleotidyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pnp PE=3 SV=1 256 334 2.0E-06
sp|Q5PAY0|PNP_ANAMM Polyribonucleotide nucleotidyltransferase OS=Anaplasma marginale (strain St. Maries) GN=pnp PE=3 SV=1 254 354 2.0E-06
sp|A5CWW8|PNP_VESOH Polyribonucleotide nucleotidyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=pnp PE=3 SV=1 249 328 2.0E-06
sp|B2JDN2|PNP_BURP8 Polyribonucleotide nucleotidyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pnp PE=3 SV=1 256 334 3.0E-06
sp|Q4L6I1|RS1_STAHJ 30S ribosomal protein S1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsA PE=3 SV=1 259 329 4.0E-06
sp|Q9JZ44|RS1_NEIMB 30S ribosomal protein S1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsA PE=1 SV=1 259 333 4.0E-06
sp|P19712|POLG_CSFVA Genome polyprotein OS=Classical swine fever virus (strain Alfort) PE=1 SV=2 563 889 5.0E-06
sp|Q97I09|ISPH_CLOAB 4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ispH PE=3 SV=1 245 332 5.0E-06
sp|A4VXQ4|PNP_STRSY Polyribonucleotide nucleotidyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=pnp PE=3 SV=1 256 343 8.0E-06
sp|A4W401|PNP_STRS2 Polyribonucleotide nucleotidyltransferase OS=Streptococcus suis (strain 98HAH33) GN=pnp PE=3 SV=2 256 343 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0004386 helicase activity Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2813
MSTQNPDHHEIGPASRRNKPRSMDQLPDIGLLSLISRVASELQNHVGASDKTLAEFLIAQRLESQSMDEFRQKID
GMGDLLPPSLVESIDRLVLTLHPKFRAKGGAANGDKQPKPSRTLQEKEQLFSALALPDKHVDSEPAEEDVMEDTM
ALLKQLGSKTRPARSSHKRSPSPMENGREARRRRRSNSRSPTRRKKDRFRSRSRSQDKGDEDWRDGYRDSHRDRR
SRKRHNDDDYQDRRYQDDGRPNPEVDDAPIIHKVYQGRVTGIKDFGAFVNLHHVRGKVDGLVHISRIAEGQRLNH
PSDFLSKGQKVYVKVLSIQGSRIGLSMKDVDQEAGLDLEPESRFSTGANSEMLGGRGRQNVPTPREALGPPTRQK
KRMTSPERWEIRQLIASGVAKASDYPDLQEDYNATLRGEGELELEEDVDIEVREEEPPFLAGQTKQSLELSPIRV
VKAPDGSMNRAAMAGTALAKERKELKQQEANTASKEEARENLSSQWHDPMADPDKRKFASDMRNTRTNARNEEVP
EWKKAVIPRNQPLGKRTNMSIKQQRELLPVFAFREQLISAIKENQILVVVGETGSGKTTQMTQYLAEAGFANDGI
IGCTQPRRVAAMSVAKRVAEEVGCKLGQEIGYTIRFEDCTSPATKIKYMTEGMLEREILMDLDLKRYSCIMLDEA
HERTIAIDVLFALLKKAVKRRPDLKVIVTSATLDADKFSAYFNECPIFTIPGRTFPVEILYSREPESDYLDTALV
TVMQIHLTEPKGDILLFLTGQEEIDTACETLFERMKALGPSVPELVILPVYSQLPTEMQSRIFEPAPPGSRKVVI
ATNIAETSITIDEIYYVVDPGFVKQNAYDPKLGMDSLVVTPISQAQANQRAGRAGRTGPGKCFRLYTEAAYQSEM
LPSTIPEIQRQNLAHTILMLKAMGINDLLHFDFMDPPPINTMLTALEELYALSALDDEGLLTRLGRKMADFPMEP
SLAKVLIAAVDFGCSEEILTIVAMLNLPNVFYRPKEKQTQADQKKSKFHDPHGDHLTLLNVYNSWKLSGHSKPWC
FENFIQERSMRRAKDVRDQLVGIMQRYKHALMSCGRDTQAVRRALCAGFFRNAARKDPTEGYKTLIEGTPVYLHP
SSALFGKHAEWVVYHTLVLTTKEYMHCTTSIEPRWLVDAAPTFFKVAPSDRLSKRRAAERIQPLYNKFAGEDDWR
LSAQRRGGRGGGGGTWG*
Coding >OphauB2|2813
ATGTCGACGCAAAATCCTGACCACCATGAAATTGGACCTGCCTCGCGCAGGAATAAACCACGCTCCATGGACCAG
CTCCCCGATATTGGGCTGTTATCGCTCATCTCCCGTGTTGCATCCGAGTTGCAAAATCATGTCGGCGCCAGCGAC
AAGACCCTGGCCGAGTTCCTCATTGCCCAGCGCCTCGAAAGCCAGTCGATGGACGAATTTCGGCAAAAAATTGAT
GGCATGGGTGACCTTCTTCCTCCAAGCTTGGTTGAAAGTATAGACCGCCTTGTTTTGACGCTGCATCCAAAGTTT
AGAGCCAAGGGCGGTGCAGCAAATGGAGACAAGCAGCCCAAGCCATCGAGGACTCTGCAGGAAAAGGAACAGCTC
TTTAGCGCCCTCGCGCTTCCCGACAAACATGTCGACAGCGAGCCGGCCGAAGAAGACGTCATGGAGGACACCATG
GCTTTGTTGAAGCAGCTGGGGAGCAAAACACGACCTGCAAGAAGCTCGCACAAGCGAAGTCCAAGCCCCATGGAA
AATGGTCGAGAGGCCAGACGGAGAAGGCGATCAAATTCTCGCTCACCGACTCGGCGAAAAAAAGACAGATTCAGG
TCTCGCTCACGGTCCCAGGACAAGGGCGACGAAGACTGGCGGGACGGATATCGAGACTCCCACAGGGACAGGCGC
AGTCGAAAACGCCACAATGACGACGATTACCAAGACAGGCGCTACCAAGACGATGGACGGCCAAACCCCGAAGTA
GATGACGCACCGATAATCCACAAAGTCTACCAGGGCCGCGTAACGGGCATCAAGGATTTTGGCGCTTTTGTCAAT
CTGCATCATGTGCGCGGCAAGGTTGACGGACTGGTACATATATCCCGAATTGCTGAAGGACAGCGATTAAATCAT
CCTTCAGACTTTCTCTCCAAGGGACAAAAAGTCTATGTCAAGGTTCTTAGCATCCAGGGGTCCCGAATTGGTCTG
TCCATGAAGGACGTGGACCAAGAGGCAGGCCTCGACTTGGAGCCCGAATCGCGCTTTTCCACCGGCGCCAACTCG
GAGATGCTGGGAGGCCGAGGTAGACAGAATGTGCCAACACCTCGAGAGGCTCTGGGACCTCCAACTCGCCAAAAG
AAGAGGATGACGTCACCCGAGAGGTGGGAGATTCGACAGCTGATTGCGTCGGGTGTTGCCAAGGCGTCGGATTAC
CCAGACCTCCAGGAAGATTACAATGCCACTTTGCGAGGAGAAGGGGAGCTGGAGCTTGAGGAAGATGTGGACATT
GAAGTACGAGAGGAGGAACCCCCCTTTCTGGCTGGGCAGACCAAGCAGTCTCTCGAGCTGTCGCCTATTAGAGTC
GTCAAGGCGCCAGATGGTTCCATGAATCGCGCTGCCATGGCTGGGACGGCATTGGCCAAGGAGAGAAAAGAGCTC
AAGCAGCAAGAGGCCAACACGGCGTCCAAGGAAGAAGCCAGAGAGAACCTTTCCTCCCAGTGGCATGATCCCATG
GCTGATCCTGACAAGCGTAAATTTGCAAGCGACATGAGGAACACGAGGACAAATGCCAGAAACGAAGAGGTGCCC
GAGTGGAAAAAGGCCGTGATACCAAGAAATCAGCCGCTGGGCAAGCGAACAAACATGAGCATCAAGCAGCAGCGC
GAGTTGTTGCCCGTCTTTGCCTTTAGAGAGCAGCTCATTTCAGCAATCAAGGAGAATCAGATTCTCGTTGTTGTT
GGAGAGACTGGATCTGGCAAGACGACGCAAATGACACAATATCTGGCCGAGGCGGGCTTTGCCAATGACGGCATC
ATTGGATGCACGCAGCCCCGACGAGTGGCTGCCATGTCAGTGGCCAAGCGTGTTGCCGAAGAAGTGGGCTGTAAA
CTGGGCCAAGAAATAGGCTACACGATTCGATTTGAAGACTGCACCAGCCCAGCCACCAAGATCAAGTACATGACG
GAGGGTATGCTGGAACGAGAGATCCTGATGGACCTGGACTTGAAGCGATATTCGTGCATTATGCTCGACGAGGCA
CACGAGCGCACCATTGCCATTGATGTGCTCTTTGCACTGCTCAAAAAGGCCGTGAAGCGCAGACCAGATCTCAAG
GTTATTGTTACATCAGCGACATTGGATGCCGATAAATTCTCAGCCTATTTCAACGAATGTCCCATTTTTACGATT
CCAGGCCGGACGTTTCCGGTGGAGATTCTCTACTCGCGAGAGCCCGAATCGGATTATCTCGACACGGCCCTGGTG
ACGGTGATGCAGATTCATCTCACGGAACCCAAGGGCGACATTTTGCTCTTTTTGACGGGCCAAGAGGAGATTGAT
ACAGCGTGCGAAACACTATTTGAGCGAATGAAGGCTCTAGGCCCCAGCGTGCCCGAACTTGTAATCCTGCCCGTG
TATTCACAGCTTCCGACGGAGATGCAAAGCCGTATTTTTGAACCAGCCCCGCCGGGAAGCCGCAAAGTGGTGATT
GCCACGAATATCGCCGAGACGTCTATTACGATTGATGAAATCTACTACGTGGTGGACCCGGGGTTTGTCAAGCAA
AACGCCTACGATCCCAAGCTGGGCATGGACTCGCTCGTTGTGACGCCTATTTCGCAGGCTCAGGCAAACCAGAGG
GCTGGACGCGCTGGACGTACGGGTCCGGGCAAATGCTTTCGTCTCTACACTGAAGCTGCGTACCAGTCGGAAATG
CTGCCCAGCACCATTCCAGAAATACAGAGGCAGAATTTGGCGCACACTATTCTCATGCTCAAGGCCATGGGCATC
AACGACTTGCTACACTTTGACTTTATGGACCCCCCGCCTATTAATACCATGCTGACAGCGCTTGAGGAGCTGTAC
GCCCTGAGCGCGCTAGATGACGAAGGCCTCTTGACACGGCTGGGCCGCAAAATGGCAGATTTTCCCATGGAGCCA
TCGCTGGCCAAGGTGCTCATTGCAGCTGTGGATTTTGGTTGCTCCGAGGAGATTCTTACCATTGTGGCCATGCTC
AACCTGCCCAACGTCTTTTACCGCCCCAAGGAAAAGCAGACGCAAGCCGATCAGAAAAAGTCAAAGTTTCACGAC
CCGCACGGCGACCATTTGACGCTGCTCAATGTCTACAATTCATGGAAGCTCAGCGGCCATTCCAAGCCCTGGTGC
TTTGAGAATTTTATCCAGGAACGTTCGATGCGGCGGGCCAAGGACGTGCGCGACCAATTGGTGGGCATCATGCAG
CGGTACAAGCACGCGCTCATGTCGTGCGGGCGCGACACGCAGGCGGTGCGGCGTGCCCTTTGCGCAGGCTTCTTC
CGCAACGCGGCGCGCAAGGACCCGACTGAGGGCTACAAGACGCTCATTGAGGGCACGCCCGTCTATCTGCACCCG
AGCTCGGCGCTCTTTGGCAAGCATGCCGAATGGGTCGTCTATCACACGCTGGTGCTCACGACAAAGGAATACATG
CACTGTACCACGAGTATCGAGCCGCGGTGGCTGGTGGATGCCGCGCCAACCTTTTTCAAGGTGGCGCCATCGGAT
AGGCTGAGCAAGCGACGGGCCGCAGAGAGGATCCAGCCGCTGTATAATAAATTTGCGGGCGAGGACGACTGGCGT
CTAAGTGCACAGCGAAGAGGAGGGCGAGGCGGCGGCGGCGGCACTTGGGGATAG
Transcript >OphauB2|2813
ATGTCGACGCAAAATCCTGACCACCATGAAATTGGACCTGCCTCGCGCAGGAATAAACCACGCTCCATGGACCAG
CTCCCCGATATTGGGCTGTTATCGCTCATCTCCCGTGTTGCATCCGAGTTGCAAAATCATGTCGGCGCCAGCGAC
AAGACCCTGGCCGAGTTCCTCATTGCCCAGCGCCTCGAAAGCCAGTCGATGGACGAATTTCGGCAAAAAATTGAT
GGCATGGGTGACCTTCTTCCTCCAAGCTTGGTTGAAAGTATAGACCGCCTTGTTTTGACGCTGCATCCAAAGTTT
AGAGCCAAGGGCGGTGCAGCAAATGGAGACAAGCAGCCCAAGCCATCGAGGACTCTGCAGGAAAAGGAACAGCTC
TTTAGCGCCCTCGCGCTTCCCGACAAACATGTCGACAGCGAGCCGGCCGAAGAAGACGTCATGGAGGACACCATG
GCTTTGTTGAAGCAGCTGGGGAGCAAAACACGACCTGCAAGAAGCTCGCACAAGCGAAGTCCAAGCCCCATGGAA
AATGGTCGAGAGGCCAGACGGAGAAGGCGATCAAATTCTCGCTCACCGACTCGGCGAAAAAAAGACAGATTCAGG
TCTCGCTCACGGTCCCAGGACAAGGGCGACGAAGACTGGCGGGACGGATATCGAGACTCCCACAGGGACAGGCGC
AGTCGAAAACGCCACAATGACGACGATTACCAAGACAGGCGCTACCAAGACGATGGACGGCCAAACCCCGAAGTA
GATGACGCACCGATAATCCACAAAGTCTACCAGGGCCGCGTAACGGGCATCAAGGATTTTGGCGCTTTTGTCAAT
CTGCATCATGTGCGCGGCAAGGTTGACGGACTGGTACATATATCCCGAATTGCTGAAGGACAGCGATTAAATCAT
CCTTCAGACTTTCTCTCCAAGGGACAAAAAGTCTATGTCAAGGTTCTTAGCATCCAGGGGTCCCGAATTGGTCTG
TCCATGAAGGACGTGGACCAAGAGGCAGGCCTCGACTTGGAGCCCGAATCGCGCTTTTCCACCGGCGCCAACTCG
GAGATGCTGGGAGGCCGAGGTAGACAGAATGTGCCAACACCTCGAGAGGCTCTGGGACCTCCAACTCGCCAAAAG
AAGAGGATGACGTCACCCGAGAGGTGGGAGATTCGACAGCTGATTGCGTCGGGTGTTGCCAAGGCGTCGGATTAC
CCAGACCTCCAGGAAGATTACAATGCCACTTTGCGAGGAGAAGGGGAGCTGGAGCTTGAGGAAGATGTGGACATT
GAAGTACGAGAGGAGGAACCCCCCTTTCTGGCTGGGCAGACCAAGCAGTCTCTCGAGCTGTCGCCTATTAGAGTC
GTCAAGGCGCCAGATGGTTCCATGAATCGCGCTGCCATGGCTGGGACGGCATTGGCCAAGGAGAGAAAAGAGCTC
AAGCAGCAAGAGGCCAACACGGCGTCCAAGGAAGAAGCCAGAGAGAACCTTTCCTCCCAGTGGCATGATCCCATG
GCTGATCCTGACAAGCGTAAATTTGCAAGCGACATGAGGAACACGAGGACAAATGCCAGAAACGAAGAGGTGCCC
GAGTGGAAAAAGGCCGTGATACCAAGAAATCAGCCGCTGGGCAAGCGAACAAACATGAGCATCAAGCAGCAGCGC
GAGTTGTTGCCCGTCTTTGCCTTTAGAGAGCAGCTCATTTCAGCAATCAAGGAGAATCAGATTCTCGTTGTTGTT
GGAGAGACTGGATCTGGCAAGACGACGCAAATGACACAATATCTGGCCGAGGCGGGCTTTGCCAATGACGGCATC
ATTGGATGCACGCAGCCCCGACGAGTGGCTGCCATGTCAGTGGCCAAGCGTGTTGCCGAAGAAGTGGGCTGTAAA
CTGGGCCAAGAAATAGGCTACACGATTCGATTTGAAGACTGCACCAGCCCAGCCACCAAGATCAAGTACATGACG
GAGGGTATGCTGGAACGAGAGATCCTGATGGACCTGGACTTGAAGCGATATTCGTGCATTATGCTCGACGAGGCA
CACGAGCGCACCATTGCCATTGATGTGCTCTTTGCACTGCTCAAAAAGGCCGTGAAGCGCAGACCAGATCTCAAG
GTTATTGTTACATCAGCGACATTGGATGCCGATAAATTCTCAGCCTATTTCAACGAATGTCCCATTTTTACGATT
CCAGGCCGGACGTTTCCGGTGGAGATTCTCTACTCGCGAGAGCCCGAATCGGATTATCTCGACACGGCCCTGGTG
ACGGTGATGCAGATTCATCTCACGGAACCCAAGGGCGACATTTTGCTCTTTTTGACGGGCCAAGAGGAGATTGAT
ACAGCGTGCGAAACACTATTTGAGCGAATGAAGGCTCTAGGCCCCAGCGTGCCCGAACTTGTAATCCTGCCCGTG
TATTCACAGCTTCCGACGGAGATGCAAAGCCGTATTTTTGAACCAGCCCCGCCGGGAAGCCGCAAAGTGGTGATT
GCCACGAATATCGCCGAGACGTCTATTACGATTGATGAAATCTACTACGTGGTGGACCCGGGGTTTGTCAAGCAA
AACGCCTACGATCCCAAGCTGGGCATGGACTCGCTCGTTGTGACGCCTATTTCGCAGGCTCAGGCAAACCAGAGG
GCTGGACGCGCTGGACGTACGGGTCCGGGCAAATGCTTTCGTCTCTACACTGAAGCTGCGTACCAGTCGGAAATG
CTGCCCAGCACCATTCCAGAAATACAGAGGCAGAATTTGGCGCACACTATTCTCATGCTCAAGGCCATGGGCATC
AACGACTTGCTACACTTTGACTTTATGGACCCCCCGCCTATTAATACCATGCTGACAGCGCTTGAGGAGCTGTAC
GCCCTGAGCGCGCTAGATGACGAAGGCCTCTTGACACGGCTGGGCCGCAAAATGGCAGATTTTCCCATGGAGCCA
TCGCTGGCCAAGGTGCTCATTGCAGCTGTGGATTTTGGTTGCTCCGAGGAGATTCTTACCATTGTGGCCATGCTC
AACCTGCCCAACGTCTTTTACCGCCCCAAGGAAAAGCAGACGCAAGCCGATCAGAAAAAGTCAAAGTTTCACGAC
CCGCACGGCGACCATTTGACGCTGCTCAATGTCTACAATTCATGGAAGCTCAGCGGCCATTCCAAGCCCTGGTGC
TTTGAGAATTTTATCCAGGAACGTTCGATGCGGCGGGCCAAGGACGTGCGCGACCAATTGGTGGGCATCATGCAG
CGGTACAAGCACGCGCTCATGTCGTGCGGGCGCGACACGCAGGCGGTGCGGCGTGCCCTTTGCGCAGGCTTCTTC
CGCAACGCGGCGCGCAAGGACCCGACTGAGGGCTACAAGACGCTCATTGAGGGCACGCCCGTCTATCTGCACCCG
AGCTCGGCGCTCTTTGGCAAGCATGCCGAATGGGTCGTCTATCACACGCTGGTGCTCACGACAAAGGAATACATG
CACTGTACCACGAGTATCGAGCCGCGGTGGCTGGTGGATGCCGCGCCAACCTTTTTCAAGGTGGCGCCATCGGAT
AGGCTGAGCAAGCGACGGGCCGCAGAGAGGATCCAGCCGCTGTATAATAAATTTGCGGGCGAGGACGACTGGCGT
CTAAGTGCACAGCGAAGAGGAGGGCGAGGCGGCGGCGGCGGCACTTGGGGATAG
Gene >OphauB2|2813
ATGTCGACGCAAAATCCTGACCACCATGAAATTGGACCTGCCTCGCGCAGGAATAAACCACGCTCCATGGACCAG
CTCCCCGATATTGGGCTGTTATCGCTCATCTCCCGTGTTGCATCCGAGTTGCAAAATCATGTCGGCGCCAGCGAC
AAGACCCTGGCCGAGTTCCTCATTGCCCAGCGCCTCGAAAGCCAGTCGATGGACGAATTTCGGCAAAAAATTGAT
GGCATGGGTGACCTTCTTCCTCCAAGCTTGGTTGAAAGTATAGACCGCCTTGTTTTGACGCTGCATCCAAAGTTT
AGAGCCAAGGGCGGTGCAGCAAATGGAGACAAGCAGCCCAAGCCATCGAGGACTCTGCAGGAAAAGGAACAGCTC
TTTAGCGCCCTCGCGCTTCCCGACAAACATGTCGACAGCGAGCCGGCCGAAGAAGACGTCATGGAGGACACCATG
GCTTTGTTGAAGCAGCTGGGGAGCAAAACACGACCTGCAAGAAGCTCGCACAAGCGAAGTCCAAGCCCCATGGAA
AATGGTCGAGAGGCCAGACGGAGAAGGCGATCAAATTCTCGCTCACCGACTCGGCGAAAAAAAGACAGATTCAGG
TCTCGCTCACGGTCCCAGGACAAGGGCGACGAAGACTGGCGGGACGGATATCGAGACTCCCACAGGGACAGGCGC
AGTCGAAAACGCCACAATGACGACGATTACCAAGACAGGCGCTACCAAGACGATGGACGGCCAAACCCCGAAGTA
GATGACGCACCGATAATCCACAAAGTCTACCAGGGCCGCGTAACGGGCATCAAGGATTTTGGCGCTTTTGTCAAT
CTGCATCATGTGCGCGGCAAGGTTGACGGACTGGTACATATATCCCGAATTGCTGAAGGACAGCGATTAAATCAT
CCTTCAGACTTTCTCTCCAAGGGACAAAAAGTCTATGTCAAGGTTCTTAGCATCCAGGGGTCCCGAATTGGTCTG
TCCATGAAGGACGTGGACCAAGAGGCAGGCCTCGACTTGGAGCCCGAATCGCGCTTTTCCACCGGCGCCAACTCG
GAGATGCTGGGAGGCCGAGGTAGACAGAATGTGCCAACACCTCGAGAGGCTCTGGGACCTCCAACTCGCCAAAAG
AAGAGGATGACGTCACCCGAGAGGTGGGAGATTCGACAGCTGATTGCGTCGGGTGTTGCCAAGGCGTCGGATTAC
CCAGACCTCCAGGAAGATTACAATGCCACTTTGCGAGGAGAAGGGGAGCTGGAGCTTGAGGAAGATGTGGACATT
GAAGTACGAGAGGAGGAACCCCCCTTTCTGGCTGGGCAGACCAAGCAGTCTCTCGAGCTGTCGCCTATTAGAGTC
GTCAAGGCGCCAGATGGTTCCATGAATCGCGCTGCCATGGCTGGGACGGCATTGGCCAAGGAGAGAAAAGAGCTC
AAGCAGCAAGAGGCCAACACGGCGTCCAAGGAAGAAGCCAGAGAGAACCTTTCCTCCCAGTGGCATGATCCCATG
GCTGATCCTGACAAGCGTAAATTTGCAAGCGACATGAGGAACACGAGGACAAATGCCAGAAACGAAGAGGTGCCC
GAGTGGAAAAAGGCCGTGATACCAAGAAATCAGCCGCTGGGCAAGCGAACAAACATGAGCATCAAGCAGCAGCGC
GAGTTGTTGCCCGTCTTTGCCTTTAGAGAGCAGCTCATTTCAGCAATCAAGGAGAATCAGATTCTCGTTGTTGTT
GGAGAGACTGGATCTGGCAAGACGACGCAAATGACACAATATCTGGCCGAGGCGGGCTTTGCCAATGACGGCATC
ATTGGATGCACGCAGCCCCGACGAGTGGCTGCCATGTCAGTGGCCAAGCGTGTTGCCGAAGAAGTGGGCTGTAAA
CTGGGCCAAGAAATAGGCTACACGATTCGATTTGAAGACTGCACCAGCCCAGCCACCAAGATCAAGTACATGACG
GAGGGTATGCTGGAACGAGAGATCCTGATGGACCTGGACTTGAAGCGATATTCGTGCATTATGCTCGACGAGGCA
CACGAGCGCACCATTGCCATTGATGTGCTCTTTGCACTGCTCAAAAAGGCCGTGAAGCGCAGACCAGATCTCAAG
GTTATTGTTACATCAGCGACATTGGATGCCGATAAATTCTCAGCCTATTTCAACGAATGTCCCATTTTTACGATT
CCAGGCCGGACGTTTCCGGTGGAGATTCTCTACTCGCGAGAGCCCGAATCGGATTATCTCGACACGGCCCTGGTG
ACGGTGATGCAGATTCATCTCACGGAACCCAAGGGCGACATTTTGCTCTTTTTGACGGGCCAAGAGGAGATTGAT
ACAGCGTGCGAAACACTATTTGAGCGAATGAAGGCTCTAGGCCCCAGCGTGCCCGAACTTGTAATCCTGCCCGTG
TATTCACAGCTTCCGACGGAGATGCAAAGCCGTATTTTTGAACCAGCCCCGCCGGGAAGCCGCAAAGTGGTGATT
GCCACGAATATCGCCGAGACGTCTATTACGATTGATGAAATCTACTACGTGGTGGACCCGGGGTTTGTCAAGCAA
AACGCCTACGATCCCAAGCTGGGCATGGACTCGCTCGTTGTGACGCCTATTTCGCAGGCTCAGGCAAACCAGAGG
GCTGGACGCGCTGGACGTACGGGTCCGGGCAAATGCTTTCGTCTCTACACTGAAGCTGCGTACCAGTCGGAAATG
CTGCCCAGCACCATTCCAGAAATACAGAGGCAGAATTTGGCGCACACTATTCTCATGCTCAAGGCCATGGGCATC
AACGACTTGCTACACTTTGACTTTATGGACCCCCCGCCTATTAATACCATGCTGACAGCGCTTGAGGAGCTGTAC
GCCCTGAGCGCGCTAGATGACGAAGGCCTCTTGACACGGCTGGGCCGCAAAATGGCAGATTTTCCCATGGAGCCA
TCGCTGGCCAAGGTGCTCATTGCAGCTGTGGATTTTGGTTGCTCCGAGGAGATTCTTACCATTGTGGCCATGCTC
AACCTGCCCAACGTCTTTTACCGCCCCAAGGAAAAGCAGACGCAAGCCGATCAGAAAAAGTCAAAGTTTCACGAC
CCGCACGGCGACCATTTGACGCTGCTCAATGTCTACAATTCATGGAAGCTCAGCGGCCATTCCAAGCCCTGGTGC
TTTGAGAATTTTATCCAGGAACGTTCGATGCGGCGGGCCAAGGACGTGCGCGACCAATTGGTGGGCATCATGCAG
CGGTACAAGCACGCGCTCATGTCGTGCGGGCGCGACACGCAGGCGGTGCGGCGTGCCCTTTGCGCAGGCTTCTTC
CGCAACGCGGCGCGCAAGGACCCGACTGAGGGCTACAAGACGCTCATTGAGGGCACGCCCGTCTATCTGCACCCG
AGCTCGGCGCTCTTTGGCAAGCATGCCGAATGGGTCGTCTATCACACGCTGGTGCTCACGACAAAGGAATACATG
CACTGTACCACGAGTATCGAGCCGCGGTGGCTGGTGGATGCCGCGCCAACCTTTTTCAAGGTGGCGCCATCGGAT
AGGCTGAGCAAGCGACGGGCCGCAGAGAGGATCCAGCCGCTGTATAATAAATTTGCGGGCGAGGACGACTGGCGT
CTAAGTGCACAGCGAAGAGGAGGGCGAGGCGGCGGCGGCGGCACTTGGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail