Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2810
Gene name
LocationContig_192:12850..14691
Strand+
Gene length (bp)1841
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 3.3E-29 100 479

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 68 564 1.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 129 151 22
3 182 201 19
4 216 238 22
5 245 267 22
6 308 330 22
7 343 365 22
8 389 411 22
9 432 451 19
10 461 483 22
11 520 542 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2810
MQMAHDATLVSQEKPAPTSTSTRLVHGAPSFEEMMYWASITRQEEHVANQAYKATTSSPSQIISLVCKARQPAAA
IPSLEARDAVVTEQEWKRASRAMRTTGWGAVFYLITTDVLGPYGAPWAFAQLGYGPGIAVFAVFGILSGYSAYIM
WKVFMGLDSDRYPLLTYGDLFARIFGNRLQHFLNVMLGIQLIFVVSLIILSSGQAISQISQSSRSPTGICFIACL
LIITAAGFLLGQVRTLQRFALLSNFATWINVLGIAICMGVVAHSPPNFKATQASYGKEFGPGPIRTFTGTPPDGL
ASGGNGMIATFNGMNSAVFSYGGSMLFITFLAEMRHPADFYKGMMLAQVFISCVYVIFGAYVYSYQGQFAFNPIM
QGLSPYAWQTAANVMYIFPCLISAALYGNICLKIIYSQLLQDVFGFPPLTERSGKVAWAASMPIYWALAFVIAAA
VPQFTFVSGFISALFMLAFTYTLPALLALGYWLKKDAMTAEEHFDPQTGTYAFQDVGWTRWKRAFVKHPLFHVLN
FIYMVAGLVTMALGVYSSIRGLISAFSGKSVATTFGCTPPV*
Coding >OphauB2|2810
ATGCAAATGGCACATGACGCGACTCTCGTCAGCCAGGAAAAGCCTGCGCCGACCAGCACGAGTACACGTCTTGTC
CACGGCGCGCCCTCGTTTGAAGAAATGATGTACTGGGCCAGCATCACGCGCCAAGAAGAACATGTAGCCAACCAG
GCATACAAGGCCACGACAAGCTCACCGTCTCAAATCATTAGCCTCGTCTGCAAGGCCCGACAACCAGCCGCCGCA
ATCCCGAGTCTAGAGGCGCGCGACGCTGTGGTGACGGAGCAGGAGTGGAAGAGGGCAAGTCGCGCCATGCGAACC
ACCGGATGGGGCGCCGTCTTTTATCTCATCACCACCGACGTGCTGGGCCCATATGGCGCGCCCTGGGCCTTTGCG
CAGCTGGGCTATGGGCCGGGAATCGCAGTCTTTGCCGTCTTTGGCATCTTGTCGGGCTACTCAGCCTACATCATG
TGGAAAGTCTTCATGGGCCTCGATTCAGACCGTTATCCGCTCCTCACCTATGGTGATCTCTTTGCCCGCATCTTT
GGCAACAGGTTGCAGCACTTTCTCAATGTCATGCTCGGCATCCAGCTCATCTTTGTCGTCTCCCTCATCATCCTC
AGCTCCGGCCAGGCCATTTCGCAGATTTCGCAGAGCAGCCGCAGCCCCACTGGCATCTGCTTCATTGCCTGTCTG
CTCATCATTACCGCCGCCGGCTTTCTCCTCGGACAGGTCCGCACCCTGCAGCGCTTTGCTCTGCTCTCCAACTTT
GCAACCTGGATCAATGTGCTCGGCATTGCCATCTGCATGGGCGTCGTGGCTCATTCACCGCCAAACTTCAAGGCC
ACGCAGGCTTCATACGGCAAGGAATTCGGCCCAGGGCCTATTCGCACCTTTACGGGCACACCACCTGATGGTCTG
GCCAGCGGCGGCAATGGCATGATTGCCACCTTTAACGGCATGAACTCGGCCGTCTTCTCCTACGGCGGCAGCATG
CTCTTCATCACCTTTCTCGCCGAGATGCGCCACCCAGCCGACTTTTACAAAGGAATGATGCTCGCCCAAGTCTTC
ATCAGCTGCGTCTACGTCATCTTTGGCGCCTACGTCTACTCCTACCAAGGCCAGTTTGCCTTTAACCCCATCATG
CAGGGTCTCTCGCCCTATGCTTGGCAAACAGCAGCCAACGTCATGTACATCTTCCCCTGTCTTATATCCGCCGCC
TTGTACGGCAACATTTGCCTCAAAATCATCTACTCCCAGCTCCTGCAAGACGTCTTTGGCTTTCCGCCATTGACG
GAGCGCTCGGGCAAGGTAGCCTGGGCCGCCAGCATGCCCATTTACTGGGCACTAGCCTTTGTCATTGCCGCCGCC
GTGCCGCAATTCACCTTTGTGTCGGGCTTTATTAGCGCCCTCTTTATGCTCGCCTTTACATATACCCTTCCTGCG
CTGCTGGCGCTGGGCTACTGGCTGAAAAAGGACGCCATGACGGCCGAGGAGCACTTTGATCCGCAGACGGGCACG
TATGCATTCCAAGACGTTGGCTGGACGCGGTGGAAACGTGCATTTGTTAAACACCCCTTGTTTCACGTCTTGAAC
TTTATCTACATGGTTGCCGGCCTTGTCACCATGGCGCTGGGTGTTTACTCGAGCATTCGGGGCCTGATTTCGGCT
TTTTCGGGCAAAAGCGTGGCGACGACTTTTGGATGCACTCCGCCTGTGTAG
Transcript >OphauB2|2810
ATGCAAATGGCACATGACGCGACTCTCGTCAGCCAGGAAAAGCCTGCGCCGACCAGCACGAGTACACGTCTTGTC
CACGGCGCGCCCTCGTTTGAAGAAATGATGTACTGGGCCAGCATCACGCGCCAAGAAGAACATGTAGCCAACCAG
GCATACAAGGCCACGACAAGCTCACCGTCTCAAATCATTAGCCTCGTCTGCAAGGCCCGACAACCAGCCGCCGCA
ATCCCGAGTCTAGAGGCGCGCGACGCTGTGGTGACGGAGCAGGAGTGGAAGAGGGCAAGTCGCGCCATGCGAACC
ACCGGATGGGGCGCCGTCTTTTATCTCATCACCACCGACGTGCTGGGCCCATATGGCGCGCCCTGGGCCTTTGCG
CAGCTGGGCTATGGGCCGGGAATCGCAGTCTTTGCCGTCTTTGGCATCTTGTCGGGCTACTCAGCCTACATCATG
TGGAAAGTCTTCATGGGCCTCGATTCAGACCGTTATCCGCTCCTCACCTATGGTGATCTCTTTGCCCGCATCTTT
GGCAACAGGTTGCAGCACTTTCTCAATGTCATGCTCGGCATCCAGCTCATCTTTGTCGTCTCCCTCATCATCCTC
AGCTCCGGCCAGGCCATTTCGCAGATTTCGCAGAGCAGCCGCAGCCCCACTGGCATCTGCTTCATTGCCTGTCTG
CTCATCATTACCGCCGCCGGCTTTCTCCTCGGACAGGTCCGCACCCTGCAGCGCTTTGCTCTGCTCTCCAACTTT
GCAACCTGGATCAATGTGCTCGGCATTGCCATCTGCATGGGCGTCGTGGCTCATTCACCGCCAAACTTCAAGGCC
ACGCAGGCTTCATACGGCAAGGAATTCGGCCCAGGGCCTATTCGCACCTTTACGGGCACACCACCTGATGGTCTG
GCCAGCGGCGGCAATGGCATGATTGCCACCTTTAACGGCATGAACTCGGCCGTCTTCTCCTACGGCGGCAGCATG
CTCTTCATCACCTTTCTCGCCGAGATGCGCCACCCAGCCGACTTTTACAAAGGAATGATGCTCGCCCAAGTCTTC
ATCAGCTGCGTCTACGTCATCTTTGGCGCCTACGTCTACTCCTACCAAGGCCAGTTTGCCTTTAACCCCATCATG
CAGGGTCTCTCGCCCTATGCTTGGCAAACAGCAGCCAACGTCATGTACATCTTCCCCTGTCTTATATCCGCCGCC
TTGTACGGCAACATTTGCCTCAAAATCATCTACTCCCAGCTCCTGCAAGACGTCTTTGGCTTTCCGCCATTGACG
GAGCGCTCGGGCAAGGTAGCCTGGGCCGCCAGCATGCCCATTTACTGGGCACTAGCCTTTGTCATTGCCGCCGCC
GTGCCGCAATTCACCTTTGTGTCGGGCTTTATTAGCGCCCTCTTTATGCTCGCCTTTACATATACCCTTCCTGCG
CTGCTGGCGCTGGGCTACTGGCTGAAAAAGGACGCCATGACGGCCGAGGAGCACTTTGATCCGCAGACGGGCACG
TATGCATTCCAAGACGTTGGCTGGACGCGGTGGAAACGTGCATTTGTTAAACACCCCTTGTTTCACGTCTTGAAC
TTTATCTACATGGTTGCCGGCCTTGTCACCATGGCGCTGGGTGTTTACTCGAGCATTCGGGGCCTGATTTCGGCT
TTTTCGGGCAAAAGCGTGGCGACGACTTTTGGATGCACTCCGCCTGTGTAG
Gene >OphauB2|2810
ATGCAAATGGCACATGACGCGACTCTCGTCAGCCAGGAAAAGCCTGCGCCGACCAGCACGAGTACACGTCTTGTC
CACGGCGCGCCCTCGTTTGAAGAAATGATGTACTGGGCCAGCATCACGCGCCAAGAAGAACATGTAGCCAACCAG
GCATACAAGGCCACGACAAGCTCACCGTCTCAAATCATTAGCCTCGTCTGCAAGGCCCGACAACCAGCCGCCGCA
ATCCCGAGTCTAGAGGCGCGCGACGCTGTGGTGACGGAGCAGGAGTGGAAGAGGGCAAGTCGCGCCATGCGAACC
ACCGGATGGGGCGCCGTCTTTTATCTCATCACCACCGACGTGCTGGGCCCATATGGCGCGCCCTGGGCCTTTGCG
CAGCTGGGCTATGGGCCGGGAATCGCAGTCTTTGCCGTCTTTGGCATCTTGTCGGGCTAGTAAGGGTTTTCCAAT
GGCCACTTGGTTGGCCCCGTTGCTGATGCTTGCTCTCCAGCTCAGCCTACATCATGTGGAAAGTCTTCATGGGCC
TCGATTCAGACCGTTATCCGCTCCTCACCTATGGTGATCTCTTTGCCCGCATCTTTGGCAACAGGTTGCAGCACT
TTCTCAATGTCATGCTCGGCATCCAGCTCATCTTTGTCGTCTCCCTCATCATCCTCAGCTCCGGCCAGGCCATTT
CGCAGATTTCGCAGAGCAGCCGCAGCCCCACTGGCATCTGCTTCATTGCCTGTCTGCTCATCATTACCGCCGCCG
GCTTTCTCCTCGGACAGGTCCGCACCCTGCAGCGCTTTGCTCTGCTCTCCAACTTTGCAACCTGGATCAATGTGC
TCGGCATTGCCATCTGGTAAGACTTGGGCTCGTCTCATGCCTCTTTTTTTCGGAAACCTTTTTGCACATGGCCAT
CTAATGCTTCCTTGTCCCATTCTAGCATGGGCGTCGTGGCTCATTCACCGCCAAACTTCAAGGCCACGCAGGCTT
CATACGGCAAGGAATTCGGCCCAGGGCCTATTCGCACCTTTACGGGCACACCACCTGATGGTCTGGCCAGCGGCG
GCAATGGCATGATTGCCACCTTTAACGGCATGAACTCGGCCGTCTTCTCCTACGGCGGCAGCATGCTCTTCATCA
CCTTTCTCGCCGAGATGCGCCACCCAGCCGACTTTTACAAAGGAATGATGCTCGCCCAAGTCTTCATCAGCTGCG
TCTACGTCATCTTTGGCGCCTACGTCTACTCCTACCAAGGCCAGTTTGCCTTTAACCCCATCATGCAGGGTCTCT
CGCCCTATGCTTGGCAAACAGCAGCCAACGTCATGTACATCTTCCCCTGTCTTATATCCGCCGCCTTGTACGGCA
ACATTTGCCTCAAAATCATCTACTCCCAGCTCCTGCAAGACGTCTTTGGCTTTCCGCCATTGACGGAGCGCTCGG
GCAAGGTAGCCTGGGCCGCCAGCATGCCCATTTACTGGGCACTAGCCTTTGTCATTGCCGCCGCCGTGCCGCAAT
TCACCTTTGTGTCGGGCTTTATTAGCGCCCTCTTTATGCTCGCCTTTACATATACCCTTCCTGCGCTGCTGGCGC
TGGGCTACTGGCTGAAAAAGGACGCCATGACGGCCGAGGAGCACTTTGATCCGCAGACGGGCACGTATGCATTCC
AAGACGTTGGCTGGACGCGGTGGAAACGTGCATTTGTTAAACACCCCTTGTTTCACGTCTTGAACTTTATCTACA
TGGTTGCCGGCCTTGTCACCATGGCGCTGGGTGTTTACTCGAGCATTCGGGGCCTGATTTCGGCTTTTTCGGGCA
AAAGCGTGGCGACGACTTTTGGATGCACTCCGCCTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail