Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|281
Gene name
LocationContig_100:36315..37747
Strand+
Gene length (bp)1432
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 68 87 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1818
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|225
Ophiocordyceps australis map64 (Brazil) OphauB2|281 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00182
Ophiocordyceps camponoti-rufipedis Ophun1|7117
Ophiocordyceps kimflemingae Ophio5|8176
Ophiocordyceps subramaniannii Hirsu2|1793

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|281
MPSVDVAMMASRRDQVVQQVRNALLRRSAASLSQRDLLVDAADRVYSVKKAFSSWDNCMKATFCKWPVIAVIIVG
SLILIGILWCIIRCACCGLSCCCSCCRCFKCCGNCCGCCDAPGQPKHKYLDEPYLPPNHGYQANAPMQAPFASAP
TKQSVFEPPQYAQFDVSKKAGDDSLPQMPSWEGGSSKHVLLEHDEVEMKDLNKPAASTSSLATPSPGLASNMAGE
AQSPMGYMAGRNAQALSPGRPSPDYNQHNYGAYASIRPQEYDNPSPSGYGYANVNNTSNSAQDPYSRPYAQPRSP
TEMPSEALYSRSHATDAYAMPWQAADSATGPYGQLSHDAAHPMRHAALPDHDMRFESPRAAPTPHGQPRYNDTGY
ASSRDHLHDAYSSAPARAPEAVWQNNAPFAQSPPESPITNNAGFDFTSGYARPSTRHGESNESQWSPPVQAYPGY
KPYQRF*
Coding >OphauB2|281
ATGCCTTCTGTAGACGTGGCCATGATGGCAAGTCGGCGCGACCAAGTAGTGCAACAAGTCAGGAATGCTCTGCTT
CGCCGCTCCGCTGCCAGCCTGTCGCAAAGAGACTTGCTTGTCGACGCCGCCGACCGAGTCTACAGCGTCAAGAAA
GCCTTTTCTAGCTGGGACAATTGCATGAAGGCAACCTTTTGCAAATGGCCCGTCATTGCCGTCATCATTGTCGGC
TCGCTCATCCTCATCGGCATCCTCTGGTGCATCATTCGCTGCGCCTGCTGTGGCCTTTCGTGCTGCTGCAGTTGC
TGTCGATGCTTCAAGTGCTGTGGAAACTGCTGCGGATGCTGCGATGCCCCGGGGCAACCAAAGCACAAGTATCTC
GACGAGCCCTACCTGCCACCCAACCACGGCTACCAGGCCAATGCCCCCATGCAGGCGCCCTTTGCTTCAGCTCCC
ACAAAGCAGTCCGTCTTCGAACCTCCGCAGTATGCACAATTCGACGTGTCCAAGAAGGCCGGCGACGATTCCCTG
CCACAGATGCCCAGCTGGGAGGGAGGAAGCTCCAAACACGTCTTGCTGGAGCATGACGAAGTCGAGATGAAGGAC
CTCAACAAGCCCGCAGCATCCACCTCGTCCCTCGCAACCCCTTCGCCTGGCCTTGCCAGCAACATGGCTGGCGAG
GCACAGAGCCCAATGGGCTACATGGCCGGCCGCAATGCCCAAGCCCTGAGCCCTGGCCGGCCATCGCCCGACTAC
AATCAGCACAATTATGGCGCATATGCCTCCATCCGCCCCCAAGAATACGACAACCCCTCCCCGTCTGGCTACGGT
TACGCCAATGTCAATAACACGAGCAACAGTGCACAGGACCCCTATTCACGCCCCTACGCCCAGCCAAGGTCACCC
ACCGAAATGCCTTCAGAAGCATTGTACTCGCGTAGTCACGCCACCGATGCGTACGCCATGCCATGGCAAGCAGCT
GACAGCGCCACGGGTCCCTATGGCCAGCTTTCCCACGATGCTGCCCACCCAATGCGACATGCTGCTCTCCCAGAC
CATGACATGCGCTTCGAGTCACCCAGGGCAGCGCCGACGCCTCATGGCCAACCCCGCTATAATGATACGGGTTAT
GCTTCATCGCGAGACCATCTTCACGATGCATATTCATCAGCACCGGCTCGAGCCCCTGAAGCTGTTTGGCAAAAC
AATGCGCCATTTGCACAATCACCCCCCGAGTCGCCTATTACTAATAACGCCGGTTTCGACTTTACCTCTGGGTAC
GCCCGTCCTTCGACTCGCCACGGGGAATCAAATGAGTCGCAATGGTCACCACCTGTCCAGGCCTATCCGGGCTAT
AAACCCTACCAAAGATTTTGA
Transcript >OphauB2|281
ATGCCTTCTGTAGACGTGGCCATGATGGCAAGTCGGCGCGACCAAGTAGTGCAACAAGTCAGGAATGCTCTGCTT
CGCCGCTCCGCTGCCAGCCTGTCGCAAAGAGACTTGCTTGTCGACGCCGCCGACCGAGTCTACAGCGTCAAGAAA
GCCTTTTCTAGCTGGGACAATTGCATGAAGGCAACCTTTTGCAAATGGCCCGTCATTGCCGTCATCATTGTCGGC
TCGCTCATCCTCATCGGCATCCTCTGGTGCATCATTCGCTGCGCCTGCTGTGGCCTTTCGTGCTGCTGCAGTTGC
TGTCGATGCTTCAAGTGCTGTGGAAACTGCTGCGGATGCTGCGATGCCCCGGGGCAACCAAAGCACAAGTATCTC
GACGAGCCCTACCTGCCACCCAACCACGGCTACCAGGCCAATGCCCCCATGCAGGCGCCCTTTGCTTCAGCTCCC
ACAAAGCAGTCCGTCTTCGAACCTCCGCAGTATGCACAATTCGACGTGTCCAAGAAGGCCGGCGACGATTCCCTG
CCACAGATGCCCAGCTGGGAGGGAGGAAGCTCCAAACACGTCTTGCTGGAGCATGACGAAGTCGAGATGAAGGAC
CTCAACAAGCCCGCAGCATCCACCTCGTCCCTCGCAACCCCTTCGCCTGGCCTTGCCAGCAACATGGCTGGCGAG
GCACAGAGCCCAATGGGCTACATGGCCGGCCGCAATGCCCAAGCCCTGAGCCCTGGCCGGCCATCGCCCGACTAC
AATCAGCACAATTATGGCGCATATGCCTCCATCCGCCCCCAAGAATACGACAACCCCTCCCCGTCTGGCTACGGT
TACGCCAATGTCAATAACACGAGCAACAGTGCACAGGACCCCTATTCACGCCCCTACGCCCAGCCAAGGTCACCC
ACCGAAATGCCTTCAGAAGCATTGTACTCGCGTAGTCACGCCACCGATGCGTACGCCATGCCATGGCAAGCAGCT
GACAGCGCCACGGGTCCCTATGGCCAGCTTTCCCACGATGCTGCCCACCCAATGCGACATGCTGCTCTCCCAGAC
CATGACATGCGCTTCGAGTCACCCAGGGCAGCGCCGACGCCTCATGGCCAACCCCGCTATAATGATACGGGTTAT
GCTTCATCGCGAGACCATCTTCACGATGCATATTCATCAGCACCGGCTCGAGCCCCTGAAGCTGTTTGGCAAAAC
AATGCGCCATTTGCACAATCACCCCCCGAGTCGCCTATTACTAATAACGCCGGTTTCGACTTTACCTCTGGGTAC
GCCCGTCCTTCGACTCGCCACGGGGAATCAAATGAGTCGCAATGGTCACCACCTGTCCAGGCCTATCCGGGCTAT
AAACCCTACCAAAGATTTTGA
Gene >OphauB2|281
ATGCCTTCTGTAGACGTGGCCATGATGGCAAGTCGGCGCGACCAAGTAGTGCAACAAGTCAGGAATGCTCTGCTT
CGCCGCTCCGCTGCCAGCCTGTCGCAAAGAGACTTGCTTGTCGACGCCGCCGACCGAGTCTACAGCGTCAAGAAA
GCCTTTTCTAGCTGGGACAATTGCATGAAGGCAACCTTTTGCAAGTATGCCAGCCCATGCACCTAGCCGCCAGCA
ATAGTGCTAATAGCCTTTGGTGCCCCTCAGATGGCCCGTCATTGCCGTCATCATTGTCGGCTCGCTCATCCTCAT
CGGCATCCTCTGGTGCATCATTCGCTGCGCCTGCTGTGGCCTTTCGTGCTGCTGCAGTTGCTGTCGATGCTTCAA
GTGCTGTGGAAACTGCTGCGGATGCTGCGATGCCCCGGGGCAACCAAAGCACAAGTATCTCGACGAGCCCTACCT
GCCACCCAACCACGGCTACCAGGCCAATGCCCCCATGCAGGCGCCCTTTGCTTCAGCTCCCACAAAGCAGTCCGT
CTTCGAACCTCCGCAGTATGCACAATTCGACGTGTCCAAGAAGGCCGGCGACGATTCCCTGCCACAGATGCCCAG
CTGGGAGGGAGGAAGCTCCAAACACGTCTTGCTGGAGCATGACGAAGTCGAGATGAAGGACCTCAACAAGCCCGC
AGCATCCACCTCGTCCCTCGCAACCCCTTCGCCTGGCCTTGCCAGCAACATGGCTGGCGAGGCACAGAGCCCAAT
GGGCTACATGGCCGGCCGCAATGCCCAAGCCCTGAGCCCTGGCCGGCCATCGCCCGACTACAATCAGCACAATTA
TGGCGCATATGCCTCCATCCGCCCCCAAGAATACGACAACCCCTCCCCGTCTGGCTACGGTTACGCCAATGTCAA
TAACACGAGCAACAGTGCACAGGACCCCTATTCACGCCCCTACGCCCAGCCAAGGTCACCCACCGAAATGCCTTC
AGAAGCATTGTACTCGCGTAGTCACGCCACCGATGCGTACGCCATGCCATGGCAAGCAGCTGACAGCGCCACGGG
TCCCTATGGCCAGCTTTCCCACGATGCTGCCCACCCAATGCGACATGCTGCTCTCCCAGACCATGACATGCGCTT
CGAGTCACCCAGGGCAGCGCCGACGCCTCATGGCCAACCCCGCTATAATGATACGGGTTATGCTTCATCGCGAGA
CCATCTTCACGATGCATATTCATCAGCACCGGCTCGAGCCCCTGAAGCTGTTTGGCAAAACAATGCGCCATTTGC
ACAATCACCCCCCGAGTCGCCTATTACTAATAACGCCGGTTTCGACTTTACCTCTGGGTACGCCCGTCCTTCGAC
TCGCCACGGGGAATCAAATGAGTCGCAATGGTCACCACCTGTCCAGGCCTATCCGGGCTATAAACCCTACCAAAG
ATTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail