Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2807
Gene name
LocationContig_192:7635..9025
Strand+
Gene length (bp)1390
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 4.0E-35 232 410
PF04851 ResIII Type III restriction enzyme, res subunit 8.7E-10 242 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 193 413 6.0E-25
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 250 420 3.0E-23
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 224 409 1.0E-21
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 224 408 2.0E-21
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 224 413 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 193 413 6.0E-25
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 250 420 3.0E-23
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 224 409 1.0E-21
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 224 408 2.0E-21
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 224 413 5.0E-21
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 224 409 5.0E-20
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 250 425 8.0E-19
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 215 408 6.0E-18
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 245 408 8.0E-18
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 250 408 2.0E-16
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 224 409 3.0E-16
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 225 419 4.0E-16
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 245 408 8.0E-16
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 239 408 1.0E-15
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 249 408 9.0E-15
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 206 408 1.0E-14
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 250 409 2.0E-14
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 251 425 2.0E-14
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 228 408 3.0E-14
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 245 408 1.0E-13
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 251 408 2.0E-13
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 251 408 2.0E-13
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 228 409 5.0E-13
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 224 409 1.0E-12
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 228 409 2.0E-12
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 250 408 2.0E-12
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 251 408 3.0E-12
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 250 408 3.0E-12
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 250 408 4.0E-12
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 277 409 7.0E-12
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 250 408 7.0E-12
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 250 408 7.0E-12
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 224 409 9.0E-12
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 224 409 1.0E-11
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 224 409 1.0E-11
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 244 425 1.0E-11
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 228 409 2.0E-11
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 246 410 2.0E-11
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 361 420 2.0E-11
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 252 409 2.0E-11
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 228 409 3.0E-11
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 141 408 5.0E-11
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 228 425 7.0E-11
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 224 409 7.0E-11
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 228 425 7.0E-11
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 222 425 8.0E-11
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 228 425 8.0E-11
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 228 409 9.0E-11
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 228 425 9.0E-11
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 224 425 1.0E-10
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 251 408 1.0E-10
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 228 409 1.0E-10
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 228 425 1.0E-10
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 285 409 1.0E-10
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 228 425 1.0E-10
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 252 409 1.0E-10
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 224 409 1.0E-10
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 228 422 2.0E-10
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 228 425 2.0E-10
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 228 425 2.0E-10
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 228 409 2.0E-10
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 252 409 3.0E-10
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 224 409 3.0E-10
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 228 409 3.0E-10
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 285 409 3.0E-10
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 219 425 4.0E-10
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 228 409 4.0E-10
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 228 409 5.0E-10
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 224 409 6.0E-10
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 361 420 6.0E-10
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 228 409 6.0E-10
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 215 408 6.0E-10
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 251 408 7.0E-10
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 190 425 8.0E-10
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 224 409 8.0E-10
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 113 409 9.0E-10
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 228 422 1.0E-09
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 224 409 1.0E-09
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 219 425 1.0E-09
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 201 409 2.0E-09
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 228 409 2.0E-09
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 228 425 2.0E-09
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 228 409 2.0E-09
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 224 409 2.0E-09
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 338 408 2.0E-09
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 228 409 2.0E-09
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 228 422 3.0E-09
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 228 422 3.0E-09
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 228 408 3.0E-09
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 190 425 4.0E-09
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 224 409 6.0E-09
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 224 409 6.0E-09
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 250 423 6.0E-09
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 228 425 6.0E-09
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 228 409 7.0E-09
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 228 408 8.0E-09
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 228 420 8.0E-09
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 228 425 1.0E-08
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 228 425 1.0E-08
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 224 425 1.0E-08
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 251 408 1.0E-08
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 228 425 1.0E-08
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 228 425 1.0E-08
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 221 420 2.0E-08
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 252 409 2.0E-08
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 228 425 2.0E-08
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 228 409 3.0E-08
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 224 425 3.0E-08
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 228 425 3.0E-08
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 228 409 3.0E-08
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 228 425 4.0E-08
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 251 408 4.0E-08
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 219 425 4.0E-08
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 228 409 5.0E-08
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 228 421 5.0E-08
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 228 409 6.0E-08
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 228 409 6.0E-08
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 228 409 6.0E-08
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 228 409 1.0E-07
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 250 423 2.0E-07
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 228 408 2.0E-07
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 228 408 2.0E-07
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 228 408 2.0E-07
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 228 408 2.0E-07
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 221 417 3.0E-07
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 221 417 3.0E-07
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 228 422 3.0E-07
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 221 417 3.0E-07
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 207 420 3.0E-07
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 252 420 3.0E-07
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 221 417 4.0E-07
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 207 420 4.0E-07
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 221 421 5.0E-07
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 247 409 1.0E-06
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 189 408 1.0E-06
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 250 423 2.0E-06
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 251 408 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup307
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6796
Ophiocordyceps australis 1348a (Ghana) OphauG2|6797
Ophiocordyceps australis map64 (Brazil) OphauB2|2807 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2808
Ophiocordyceps camponoti-floridani Ophcf2|06311
Ophiocordyceps camponoti-rufipedis Ophun1|2261
Ophiocordyceps kimflemingae Ophio5|945
Ophiocordyceps kimflemingae Ophio5|946
Ophiocordyceps kimflemingae Ophio5|947
Ophiocordyceps subramaniannii Hirsu2|11002

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2807
MDIDELQMEDALDSNGDSNDDSNGSSQKFYAEPDVVESENEKIPGDSKSASNMSSEDSSDSEYSDSSDTDTGSES
DERRSKKRRRRKADKKTRQQSGKARKPAKTAREYVARLAQRDEEAMKKSPISAGQKRKRKIDGQDILKRIGLDSG
TTTGNQVAAPAPEMPDIAAPRRKDLLALLKASVPEGADTRRTNTQAKDLDEACKIFGYKKIKTGKDKTLRHRSMR
TPLKGFQITASAWMVKRECYPEKPQGGILADAMGMGKTMMSMACIVGNPPDKEDIKNFCRTTLVIVPNQSTALQW
KSEVQEHCKHPFDSRVDVYRPVEHRNKPLGYGKALKFLIITYQQLVIAFEQNVKLTRKQPGNLLNIKWYRVILDE
AHAIKNENSQTSVACCALESKYRWALSGTPLSNSSNGMKENFQCLCWAHL*
Coding >OphauB2|2807
ATGGATATCGACGAACTACAGATGGAAGACGCCCTCGATAGCAATGGCGATAGCAATGACGATAGCAATGGCAGC
AGCCAAAAGTTTTACGCAGAACCCGATGTTGTTGAAAGCGAAAACGAGAAAATACCTGGTGACTCAAAGTCGGCC
TCGAACATGAGCTCTGAAGATAGTTCGGACTCCGAATACTCTGATTCGTCAGACACAGACACAGGTAGCGAGTCT
GATGAAAGAAGATCTAAAAAACGCCGTCGGCGGAAGGCAGACAAGAAAACAAGACAACAGTCTGGAAAGGCAAGG
AAGCCAGCAAAGACTGCCAGAGAGTATGTTGCTCGGCTTGCTCAACGAGACGAAGAGGCTATGAAGAAATCGCCA
ATATCGGCTGGCCAAAAGCGAAAACGTAAGATCGATGGCCAAGACATTTTAAAGAGAATCGGTCTTGATTCCGGC
ACAACTACTGGTAATCAAGTTGCAGCCCCTGCACCTGAAATGCCTGATATTGCTGCGCCTAGGCGCAAAGATCTC
TTGGCCTTGCTCAAAGCTAGCGTTCCAGAAGGTGCAGATACAAGGCGAACTAATACACAGGCAAAAGATCTTGAC
GAAGCTTGCAAGATATTCGGCTATAAGAAGATCAAGACGGGGAAGGACAAGACTTTGAGACATAGGTCTATGAGA
ACACCCTTGAAAGGCTTCCAAATTACTGCTTCTGCATGGATGGTTAAGAGAGAGTGCTACCCAGAAAAACCCCAA
GGAGGCATACTAGCAGATGCCATGGGGATGGGAAAAACAATGATGAGCATGGCTTGCATTGTTGGGAATCCTCCC
GATAAAGAGGATATCAAGAACTTTTGCAGGACAACTTTAGTTATTGTGCCTAACCAGTCCACTGCGTTGCAGTGG
AAATCAGAGGTCCAAGAGCACTGCAAACACCCTTTCGATTCACGGGTTGACGTGTACCGGCCAGTTGAACATCGT
AATAAACCTTTGGGTTACGGTAAAGCGTTAAAATTTTTGATTATTACATATCAACAACTCGTGATTGCTTTTGAG
CAGAATGTAAAACTCACTCGGAAGCAACCAGGAAACCTCCTCAATATCAAGTGGTACAGGGTCATTCTCGATGAA
GCTCATGCAATCAAGAATGAAAACAGCCAAACAAGTGTAGCATGCTGCGCACTGGAAAGCAAGTATCGATGGGCC
TTGAGCGGCACGCCACTGTCAAACTCCTCCAACGGTATGAAGGAAAATTTCCAATGCTTGTGCTGGGCTCATTTA
TAA
Transcript >OphauB2|2807
ATGGATATCGACGAACTACAGATGGAAGACGCCCTCGATAGCAATGGCGATAGCAATGACGATAGCAATGGCAGC
AGCCAAAAGTTTTACGCAGAACCCGATGTTGTTGAAAGCGAAAACGAGAAAATACCTGGTGACTCAAAGTCGGCC
TCGAACATGAGCTCTGAAGATAGTTCGGACTCCGAATACTCTGATTCGTCAGACACAGACACAGGTAGCGAGTCT
GATGAAAGAAGATCTAAAAAACGCCGTCGGCGGAAGGCAGACAAGAAAACAAGACAACAGTCTGGAAAGGCAAGG
AAGCCAGCAAAGACTGCCAGAGAGTATGTTGCTCGGCTTGCTCAACGAGACGAAGAGGCTATGAAGAAATCGCCA
ATATCGGCTGGCCAAAAGCGAAAACGTAAGATCGATGGCCAAGACATTTTAAAGAGAATCGGTCTTGATTCCGGC
ACAACTACTGGTAATCAAGTTGCAGCCCCTGCACCTGAAATGCCTGATATTGCTGCGCCTAGGCGCAAAGATCTC
TTGGCCTTGCTCAAAGCTAGCGTTCCAGAAGGTGCAGATACAAGGCGAACTAATACACAGGCAAAAGATCTTGAC
GAAGCTTGCAAGATATTCGGCTATAAGAAGATCAAGACGGGGAAGGACAAGACTTTGAGACATAGGTCTATGAGA
ACACCCTTGAAAGGCTTCCAAATTACTGCTTCTGCATGGATGGTTAAGAGAGAGTGCTACCCAGAAAAACCCCAA
GGAGGCATACTAGCAGATGCCATGGGGATGGGAAAAACAATGATGAGCATGGCTTGCATTGTTGGGAATCCTCCC
GATAAAGAGGATATCAAGAACTTTTGCAGGACAACTTTAGTTATTGTGCCTAACCAGTCCACTGCGTTGCAGTGG
AAATCAGAGGTCCAAGAGCACTGCAAACACCCTTTCGATTCACGGGTTGACGTGTACCGGCCAGTTGAACATCGT
AATAAACCTTTGGGTTACGGTAAAGCGTTAAAATTTTTGATTATTACATATCAACAACTCGTGATTGCTTTTGAG
CAGAATGTAAAACTCACTCGGAAGCAACCAGGAAACCTCCTCAATATCAAGTGGTACAGGGTCATTCTCGATGAA
GCTCATGCAATCAAGAATGAAAACAGCCAAACAAGTGTAGCATGCTGCGCACTGGAAAGCAAGTATCGATGGGCC
TTGAGCGGCACGCCACTGTCAAACTCCTCCAACGGTATGAAGGAAAATTTCCAATGCTTGTGCTGGGCTCATTTA
TAA
Gene >OphauB2|2807
ATGGATATCGACGAACTACAGATGGAAGACGCCCTCGATAGCAATGGCGATAGCAATGACGATAGCAATGGCAGC
AGCCAAAAGTTTTACGCAGAACCCGATGTTGTTGAAAGCGAAAACGAGAAAATACCTGGTGACTCAAAGTCGGCC
TCGAACATGAGCTCTGAAGATAGTTCGGACTCCGAATACTCTGATTCGTCAGACACAGACACAGGTAGCGAGTCT
GATGAAAGAAGATCTAAAAAACGCCGTCGGCGGAAGGCAGACAAGAAAACAAGACAACAGTCTGGAAAGGCAAGG
AAGCCAGCAAAGACTGCCAGAGAGTATGTTGCTCGGCTTGCTCAACGAGACGAAGAGGCTATGAAGAAATCGCCA
ATATCGGCTGGCCAAAAGCGAAAACGTAAGATCGATGGCCAAGACATTTTAAAGAGAATCGGTCTTGATTCCGGC
ACAACTACTGGTAATCAAGTTGCAGCCCCTGCACCTGAAATGCCTGATATTGCTGCGCCTAGGCGCAAAGATCTC
TTGGCCTTGCTCAAAGCTAGCGTTCCAGAAGGTGCAGATACAAGGCGAACTAATACACAGGCAAAAGATCTTGAC
GAAGCTTGCAAGATATTCGGCTATAAGAAGATCAAGACGGGGAAGGACAAGACTTTGAGACATAGGTCTATGAGA
ACACCCTTGAAAGGCTTCCAAATTACTGCTTCTGCATGGATGGTTAAGAGAGAGTGCTACCCAGAAAAACCCCAA
GGAGGCATACTAGCAGATGCCATGGGGATGGGAAAAACAATGATGAGCATGGCTTGCATTGTTGGGAATCCTCCC
GATAAAGAGGATATCAAGAACTTTTGCAGGACAACTTTAGTTATTGTGCCTAACCAGTCCACTGCGTTGCAGTGG
AAATCAGAGGTCCAAGAGCACTGCAAACACCCTTTCGATTCACGGGTTGACGTGTACCGGCCAGTTGAACATCGT
AATAAACCTTTGGGTTACGGTAAAGCGTTAAAATTTTTGTGCGCTAAGAAGAGCCTATATCTCAATGGAGAGGCC
AATGATAGACTGACAGGAAAATAGGATTATTACATATCAACAACTCGTGATTGCTTTTGAGCAGAATGTAAAACT
CACTCGGAAGCAACCAGGAAACCTCCTCAATATCAAGTGGTACAGGGTCATTCTCGATGAAGCTCATGCAATCAA
GAATGAAAACAGCCAAAGTGAGTTAGGTTCTTCAAGTCAAGGGCTGAGTCAGTACTAAAGGATGGTAGCAAGTGT
AGCATGCTGCGCACTGGAAAGCAAGTATCGATGGGCCTTGAGCGGCACGCCACTGTCAAACTCCTCCAACGGTAT
GAAGGAAAATTTCCAATGCTTGTGCTGGGCTCATTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail