Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2806
Gene name
LocationContig_192:3814..5470
Strand-
Gene length (bp)1656
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 1.3E-41 1 140
PF11970 GPR_Gpa2_C G protein-coupled glucose receptor regulating Gpa2 C-term 2.2E-18 390 457

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12361|GPR1_YEAST G protein-coupled receptor GPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPR1 PE=1 SV=1 1 135 2.0E-15
sp|O94744|GIT3_SCHPO Glucose receptor protein git3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git3 PE=3 SV=1 27 144 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 55 22
3 70 92 22
4 113 135 22
5 400 422 22
6 429 451 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2806
MLKAIWFVILPAVELAGGPVASESLICQASGFFLAVGIEACDIAVVLIAIHTALYIFHSGNGLYLYRRPAYAAFV
LVPLILASLAFINKPAFTNTGQYCYLPRHPSWARRALSWIPRYIILATICATYVFTYSYVKILISRFGEAGTWRG
EGATPASSRRERFGRNKNRSVMRTSSLPPTPRISYHGLIPPTPPREAGSLEKKEAKLSTSTAARTSSGDGAGPMD
EGSDLTTIRKTLLSPVPENGIKWKIPQFGSHSSFLEDQQPRALSDGNIPSAITITSRPSAVSEGKASRMHSGASK
VHLSTPTSRVPSSSSRPPSGSSTMRIHSPQPSTPRHFWNRSLAVTATPASQVPSESNIVAMLRRGPGGSDSSGSV
LLSPTALESTGMGRTRDKIRRQLRQLFIYPGVYIVVWLVPFVSHIVGDDSSFVLVLASLVSLCAQGIADVLVFSV
LEKPWRHPRRNSAEATSWCTQLWRPGRAVGEVSGAGSAVKVGRTREEMMVDSRVARRRREEELAERRLLQMAPTP
HRREWWDVHLADVNESDDHSVDRATV*
Coding >OphauB2|2806
ATGCTCAAGGCCATTTGGTTTGTCATTCTCCCGGCTGTTGAGCTCGCCGGCGGCCCAGTCGCGTCCGAATCCCTC
ATCTGCCAAGCGAGTGGTTTTTTCCTTGCCGTCGGTATCGAGGCCTGCGATATAGCCGTCGTGCTCATTGCCATA
CACACCGCGCTCTATATTTTCCACAGCGGAAACGGCTTGTACCTATACCGTCGACCTGCATACGCCGCCTTTGTC
TTGGTGCCGCTGATCCTTGCTTCGCTGGCCTTTATCAACAAACCAGCCTTTACCAATACAGGCCAGTACTGCTAC
CTGCCTCGACACCCGAGCTGGGCTCGACGCGCCCTGAGTTGGATCCCGCGATATATAATTTTGGCTACCATTTGC
GCCACGTACGTCTTTACTTACTCGTACGTCAAGATTCTCATTTCGAGGTTTGGCGAAGCAGGTACGTGGCGAGGA
GAGGGCGCGACTCCAGCGAGCTCTAGACGGGAACGTTTTGGAAGAAACAAGAACCGCAGTGTAATGAGGACAAGC
TCTCTTCCGCCCACGCCCCGGATATCCTACCACGGCCTCATTCCTCCGACGCCACCTCGAGAAGCTGGGTCTTTG
GAGAAGAAAGAGGCCAAGCTATCTACTTCTACGGCTGCACGTACCTCATCGGGTGATGGGGCAGGTCCCATGGAC
GAAGGTTCTGATTTGACGACGATTCGCAAGACTCTGCTTTCACCAGTTCCTGAAAATGGAATCAAGTGGAAGATT
CCGCAATTTGGTAGTCATTCTTCTTTTCTAGAAGACCAACAGCCACGAGCACTTTCAGATGGCAATATTCCGTCA
GCCATTACCATTACAAGTCGCCCCAGTGCTGTAAGTGAAGGAAAAGCATCACGGATGCACTCTGGCGCGTCCAAG
GTGCATTTATCCACGCCGACATCTAGAGTGCCGTCATCCTCTTCGCGACCGCCTTCTGGATCTTCAACGATGCGA
ATACACTCTCCACAACCTTCGACACCTCGACACTTTTGGAACCGGTCGCTTGCAGTCACAGCAACGCCAGCCTCG
CAGGTGCCGTCAGAGTCGAATATCGTGGCAATGCTGCGTCGAGGCCCTGGTGGCTCTGATTCTTCAGGCAGTGTT
CTTTTGTCACCAACAGCCTTGGAATCAACAGGCATGGGCAGAACACGCGATAAGATACGGCGCCAGCTGCGGCAG
CTCTTTATCTACCCAGGCGTCTATATTGTCGTGTGGCTGGTCCCCTTTGTCTCTCACATTGTGGGTGACGACTCA
TCGTTTGTATTAGTCTTGGCAAGTCTTGTTAGCCTGTGTGCGCAAGGAATTGCCGACGTTCTCGTCTTTTCAGTG
CTGGAGAAGCCATGGCGGCATCCACGGCGCAATAGTGCGGAAGCCACAAGCTGGTGTACACAGCTGTGGCGTCCG
GGGCGAGCTGTGGGCGAGGTTAGCGGTGCCGGCTCGGCCGTCAAGGTGGGACGGACGCGCGAAGAAATGATGGTG
GACAGCCGAGTGGCGAGAAGGCGGCGCGAGGAGGAGCTGGCGGAGAGGAGGCTTTTGCAAATGGCGCCAACGCCC
CATCGACGAGAGTGGTGGGATGTACATTTGGCGGATGTAAATGAATCCGATGACCACTCGGTCGATCGAGCGACG
GTGTAA
Transcript >OphauB2|2806
ATGCTCAAGGCCATTTGGTTTGTCATTCTCCCGGCTGTTGAGCTCGCCGGCGGCCCAGTCGCGTCCGAATCCCTC
ATCTGCCAAGCGAGTGGTTTTTTCCTTGCCGTCGGTATCGAGGCCTGCGATATAGCCGTCGTGCTCATTGCCATA
CACACCGCGCTCTATATTTTCCACAGCGGAAACGGCTTGTACCTATACCGTCGACCTGCATACGCCGCCTTTGTC
TTGGTGCCGCTGATCCTTGCTTCGCTGGCCTTTATCAACAAACCAGCCTTTACCAATACAGGCCAGTACTGCTAC
CTGCCTCGACACCCGAGCTGGGCTCGACGCGCCCTGAGTTGGATCCCGCGATATATAATTTTGGCTACCATTTGC
GCCACGTACGTCTTTACTTACTCGTACGTCAAGATTCTCATTTCGAGGTTTGGCGAAGCAGGTACGTGGCGAGGA
GAGGGCGCGACTCCAGCGAGCTCTAGACGGGAACGTTTTGGAAGAAACAAGAACCGCAGTGTAATGAGGACAAGC
TCTCTTCCGCCCACGCCCCGGATATCCTACCACGGCCTCATTCCTCCGACGCCACCTCGAGAAGCTGGGTCTTTG
GAGAAGAAAGAGGCCAAGCTATCTACTTCTACGGCTGCACGTACCTCATCGGGTGATGGGGCAGGTCCCATGGAC
GAAGGTTCTGATTTGACGACGATTCGCAAGACTCTGCTTTCACCAGTTCCTGAAAATGGAATCAAGTGGAAGATT
CCGCAATTTGGTAGTCATTCTTCTTTTCTAGAAGACCAACAGCCACGAGCACTTTCAGATGGCAATATTCCGTCA
GCCATTACCATTACAAGTCGCCCCAGTGCTGTAAGTGAAGGAAAAGCATCACGGATGCACTCTGGCGCGTCCAAG
GTGCATTTATCCACGCCGACATCTAGAGTGCCGTCATCCTCTTCGCGACCGCCTTCTGGATCTTCAACGATGCGA
ATACACTCTCCACAACCTTCGACACCTCGACACTTTTGGAACCGGTCGCTTGCAGTCACAGCAACGCCAGCCTCG
CAGGTGCCGTCAGAGTCGAATATCGTGGCAATGCTGCGTCGAGGCCCTGGTGGCTCTGATTCTTCAGGCAGTGTT
CTTTTGTCACCAACAGCCTTGGAATCAACAGGCATGGGCAGAACACGCGATAAGATACGGCGCCAGCTGCGGCAG
CTCTTTATCTACCCAGGCGTCTATATTGTCGTGTGGCTGGTCCCCTTTGTCTCTCACATTGTGGGTGACGACTCA
TCGTTTGTATTAGTCTTGGCAAGTCTTGTTAGCCTGTGTGCGCAAGGAATTGCCGACGTTCTCGTCTTTTCAGTG
CTGGAGAAGCCATGGCGGCATCCACGGCGCAATAGTGCGGAAGCCACAAGCTGGTGTACACAGCTGTGGCGTCCG
GGGCGAGCTGTGGGCGAGGTTAGCGGTGCCGGCTCGGCCGTCAAGGTGGGACGGACGCGCGAAGAAATGATGGTG
GACAGCCGAGTGGCGAGAAGGCGGCGCGAGGAGGAGCTGGCGGAGAGGAGGCTTTTGCAAATGGCGCCAACGCCC
CATCGACGAGAGTGGTGGGATGTACATTTGGCGGATGTAAATGAATCCGATGACCACTCGGTCGATCGAGCGACG
GTGTAA
Gene >OphauB2|2806
ATGCTCAAGGCCATTTGGTTTGTCATTCTCCCGGCTGTTGAGCTCGCCGGCGGCCCAGTCGCGTCCGAATCCCTC
ATCTGCCAAGCGAGTGGTTTTTTCCTTGCCGTCGGTATCGAGGCCTGCGATATAGCCGTCGTGCTCATTGCCATA
CACACCGCGCTCTATATTTTCCACAGCGGAAACGGCTTGTACCTATACCGTCGACCTGCATACGCCGCCTTTGTC
TTGGTGCCGCTGATCCTTGCTTCGCTGGCCTTTATCAACAAACCAGCCTTTACCAATACAGGCCAGTACTGCTAC
CTGCCTCGACACCCGAGCTGGGCTCGACGCGCCCTGAGTTGGATCCCGCGATATATAATTTTGGCTACCATTTGC
GCCACGTACGTCTTTACTTACTCGTACGTCAAGATTCTCATTTCGAGGTTTGGCGAAGCAGGTACGTGGCGAGGA
GAGGGCGCGACTCCAGCGAGCTCTAGACGGGAACGTTTTGGAAGAAACAAGAACCGCAGTGTAATGAGGACAAGC
TCTCTTCCGCCCACGCCCCGGATATCCTACCACGGCCTCATTCCTCCGACGCCACCTCGAGAAGCTGGGTCTTTG
GAGAAGAAAGAGGCCAAGCTATCTACTTCTACGGCTGCACGTACCTCATCGGGTGATGGGGCAGGTCCCATGGAC
GAAGGTTCTGATTTGACGACGATTCGCAAGACTCTGCTTTCACCAGTTCCTGAAAATGGAATCAAGTGGAAGATT
CCGCAATTTGGTAGTCATTCTTCTTTTCTAGAAGACCAACAGCCACGAGCACTTTCAGATGGCAATATTCCGTCA
GCCATTACCATTACAAGTCGCCCCAGTGCTGTAAGTGAAGGAAAAGCATCACGGATGCACTCTGGCGCGTCCAAG
GTGCATTTATCCACGCCGACATCTAGAGTGCCGTCATCCTCTTCGCGACCGCCTTCTGGATCTTCAACGATGCGA
ATACACTCTCCACAACCTTCGACACCTCGACACTTTTGGAACCGGTCGCTTGCAGTCACAGCAACGCCAGCCTCG
CAGGTGCCGTCAGAGTCGAATATCGTGGCAATGCTGCGTCGAGGCCCTGGTGGCTCTGATTCTTCAGGCAGTGTT
CTTTTGTCACCAACAGCCTTGGAATCAACAGGCATGGGCAGAACACGCGATAAGATACGGCGCCAGCTGCGGCAG
CTCTTTATCTACCCAGGCGTCTATATTGTCGTGTGGCTGGTCCCCTTTGTCTCTCACATTGTGGGTGACGACTCA
TCGTTTGTATTAGTCTTGGCAAGTCTTGTTAGCCTGTGTGCGCAAGGAATTGCCGACGTTCTCGTCTTTTCAGTG
CTGGAGAAGCCATGGCGGCATCCACGGCGCAATAGTGCGGAAGCCACAAGCTGGTGTACACAGCTGTGGCGTCCG
GGGCGAGCTGTGGGCGAGGTTAGCGGTGCCGGCTCGGCCGTCAAGGTGGGACGGACGCGCGAAGAAATGATGGTG
GACAGCCGAGTGGCGAGAAGGCGGCGCGAGGAGGAGCTGGCGGAGAGGAGGCTTTTGCAAATGGCGCCAACGCCC
CATCGACGAGAGTGGTGGGATGTACATTTGGCGGATGTAAATGAATCCGATGACCACTCGGTCGATCGAGCGACG
GTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail