Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2805
Gene name
LocationContig_192:2021..2939
Strand+
Gene length (bp)918
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00117 GATase Glutamine amidotransferase class-I 7.2E-11 69 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09686|YA14_SCHPO Putative glutamine amidotransferase-like protein C13C5.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.04 PE=3 SV=1 9 250 5.0E-47
sp|Q12288|YL126_YEAST Putative glutamine amidotransferase YLR126C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR126C PE=1 SV=1 47 207 1.0E-23
sp|Q8U0R9|GUAAA_PYRFU GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=guaAA PE=3 SV=1 63 202 5.0E-09
sp|Q5JFM4|GUAAA_THEKO GMP synthase [glutamine-hydrolyzing] subunit A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=guaAA PE=3 SV=1 63 202 1.0E-08
sp|Q9Y933|GUAA_AERPE GMP synthase [glutamine-hydrolyzing] OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=guaA PE=3 SV=1 110 202 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09686|YA14_SCHPO Putative glutamine amidotransferase-like protein C13C5.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.04 PE=3 SV=1 9 250 5.0E-47
sp|Q12288|YL126_YEAST Putative glutamine amidotransferase YLR126C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR126C PE=1 SV=1 47 207 1.0E-23
sp|Q8U0R9|GUAAA_PYRFU GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=guaAA PE=3 SV=1 63 202 5.0E-09
sp|Q5JFM4|GUAAA_THEKO GMP synthase [glutamine-hydrolyzing] subunit A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=guaAA PE=3 SV=1 63 202 1.0E-08
sp|Q9Y933|GUAA_AERPE GMP synthase [glutamine-hydrolyzing] OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=guaA PE=3 SV=1 110 202 1.0E-08
sp|O59071|GUAAA_PYRHO GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=guaAA PE=1 SV=1 63 214 3.0E-07
sp|Q9V0I6|GUAAA_PYRAB GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=guaAA PE=3 SV=1 70 202 4.0E-07
sp|P40194|YFEJ_SALTY Putative glutamine amidotransferase-like protein YfeJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yfeJ PE=3 SV=2 68 235 1.0E-06
sp|Q87S07|GUAA_VIBPA GMP synthase [glutamine-hydrolyzing] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=guaA PE=3 SV=1 103 235 2.0E-06
sp|Q0W700|GUAAA_METAR GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=guaAA PE=3 SV=1 110 205 3.0E-06
sp|C1CQS0|GUAA_STRZT GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|B7VJU8|GUAA_VIBTL GMP synthase [glutamine-hydrolyzing] OS=Vibrio tasmaniensis (strain LGP32) GN=guaA PE=3 SV=1 103 205 4.0E-06
sp|B2IQR1|GUAA_STRPS GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain CGSP14) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|Q04JQ8|GUAA_STRP2 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|B5E5U0|GUAA_STRP4 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|C1C842|GUAA_STRP7 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain 70585) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|B1ICM9|GUAA_STRPI GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|P64297|GUAA_STRPN GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|P64298|GUAA_STRR6 GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|C1CLE8|GUAA_STRZP GMP synthase [glutamine-hydrolyzing] OS=Streptococcus pneumoniae (strain P1031) GN=guaA PE=3 SV=1 85 214 4.0E-06
sp|Q47DK8|GUAA_DECAR GMP synthase [glutamine-hydrolyzing] OS=Dechloromonas aromatica (strain RCB) GN=guaA PE=3 SV=1 108 230 4.0E-06
sp|Q39F73|GUAA_BURL3 GMP synthase [glutamine-hydrolyzing] OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=guaA PE=3 SV=1 52 220 5.0E-06
sp|A3CTG9|GUAAA_METMJ GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=guaAA PE=3 SV=1 72 213 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2805
MSAASPIRLAVLECDTPQPQTRAIYNNYTGVFTALLGAAAQSLDPPLDPAAALRVSAYDVVNELHTYPNLDDIDA
VLVTGSRHTAFDADPWIKNLVDFTRRALDSGRVRVVGVCFGHQIVGRALGARVCQSDKGWELAVTDVDLTDKGKE
IFQLDKMRIHQMHHDIVADFPADAVPLASNAFCPVQAMYQPGRYLTVQGHPEFTNEIISEILFNRHTVGIFTDQV
YEDGIRRSAEPHDGVAVGRAFLRFMQQG*
Coding >OphauB2|2805
ATGTCCGCGGCGTCGCCCATTCGCCTCGCCGTGCTTGAATGCGACACGCCGCAACCGCAGACCCGCGCCATCTAT
AACAACTACACGGGCGTCTTTACCGCCCTCCTCGGCGCCGCCGCACAGTCTCTTGACCCTCCGCTCGATCCGGCC
GCCGCCCTGCGCGTCTCGGCCTACGACGTTGTCAATGAGCTGCACACATACCCAAACCTCGACGACATTGACGCC
GTGCTCGTCACCGGCTCCCGCCACACCGCCTTTGATGCCGATCCCTGGATCAAGAACCTGGTCGACTTTACCCGC
CGCGCCCTCGACTCGGGCCGCGTGCGTGTCGTGGGCGTCTGCTTTGGCCACCAAATCGTTGGCCGAGCCTTGGGC
GCGCGCGTCTGCCAGAGCGACAAGGGCTGGGAACTCGCCGTCACAGACGTCGACTTGACAGACAAGGGCAAGGAG
ATTTTCCAGCTTGATAAAATGCGCATCCACCAAATGCACCACGACATTGTTGCAGACTTTCCTGCTGATGCCGTG
CCCTTGGCCTCGAATGCTTTTTGCCCCGTTCAGGCCATGTACCAGCCCGGCCGCTACCTGACGGTCCAAGGCCAT
CCCGAGTTTACCAATGAAATCATCTCTGAAATCCTCTTCAACCGCCACACCGTCGGAATCTTTACCGACCAAGTC
TACGAAGACGGCATACGTCGCTCCGCTGAGCCCCACGATGGAGTCGCCGTTGGCAGAGCGTTTTTGAGATTTATG
CAGCAGGGCTGA
Transcript >OphauB2|2805
ATGTCCGCGGCGTCGCCCATTCGCCTCGCCGTGCTTGAATGCGACACGCCGCAACCGCAGACCCGCGCCATCTAT
AACAACTACACGGGCGTCTTTACCGCCCTCCTCGGCGCCGCCGCACAGTCTCTTGACCCTCCGCTCGATCCGGCC
GCCGCCCTGCGCGTCTCGGCCTACGACGTTGTCAATGAGCTGCACACATACCCAAACCTCGACGACATTGACGCC
GTGCTCGTCACCGGCTCCCGCCACACCGCCTTTGATGCCGATCCCTGGATCAAGAACCTGGTCGACTTTACCCGC
CGCGCCCTCGACTCGGGCCGCGTGCGTGTCGTGGGCGTCTGCTTTGGCCACCAAATCGTTGGCCGAGCCTTGGGC
GCGCGCGTCTGCCAGAGCGACAAGGGCTGGGAACTCGCCGTCACAGACGTCGACTTGACAGACAAGGGCAAGGAG
ATTTTCCAGCTTGATAAAATGCGCATCCACCAAATGCACCACGACATTGTTGCAGACTTTCCTGCTGATGCCGTG
CCCTTGGCCTCGAATGCTTTTTGCCCCGTTCAGGCCATGTACCAGCCCGGCCGCTACCTGACGGTCCAAGGCCAT
CCCGAGTTTACCAATGAAATCATCTCTGAAATCCTCTTCAACCGCCACACCGTCGGAATCTTTACCGACCAAGTC
TACGAAGACGGCATACGTCGCTCCGCTGAGCCCCACGATGGAGTCGCCGTTGGCAGAGCGTTTTTGAGATTTATG
CAGCAGGGCTGA
Gene >OphauB2|2805
ATGTCCGCGGCGTCGCCCATTCGCCTCGCCGTGCTTGAATGCGACACGCCGCAACCGCAGACCCGCGCCATCTAT
AACAACTACACGGGCGTCTTTACCGCCCTCCTCGGCGCCGCCGCACAGTCTCTTGACCCTCCGCTCGATCCGGCC
GCCGCCCTGCGCGTCTCGGCCTACGACGTTGTCAATGAGCTGCACACATACCCAAACCTCGACGACATTGACGCC
GTGCTCGTCACCGGCTCCCGCCACACCGCCTTTGATGCCGATCCCTGGATCAAGAACCTGGTCGACTTTACCCGC
CGCGCCCTCGACTCGGGCCGCGTGCGTGTCGTGGGCGTCTGCTTTGGCCACCAAATCGTTGGCCGAGCCTTGGGC
GCGCGCGTCTGCCAGAGCGACAAGGGCTGGGAACTCGCCGTCACAGACGTCGACTTGACAGACAAGGGCAAGGAG
ATTTTCCAGCTTGATAAAATGGTTAGTCTTTGCCCCTCGTGTCCGCGCGGCTAGCTCGTCAATGCCTCGTCTACT
TGCGACAGGCTTGGCCAACTTGCCCTCCGCGTTTCCACTCTTTGCCTGACTCGTTGCTAATCTTTTGCTCTCCCT
CTTCCTCTTGCTCTTGTCTCTTTCTAGCGCATCCACCAAATGCACCACGACATTGTTGCAGACTTTCCTGCTGAT
GCCGTGCCCTTGGCCTCGAATGCTTTTTGCCCCGTTCAGGCCATGTACCAGCCCGGCCGCTACCTGACGGTCCAA
GGCCATCCCGAGTTTACCAATGAAATCATCTCTGAAATCCTCTTCAACCGCCACACCGTCGGAATCTTTACCGAC
CAAGTCTACGAAGACGGCATACGTCGCTCCGCTGAGCCCCACGATGGAGTCGCCGTTGGCAGAGCGTTTTTGAGA
TTTATGCAGCAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail