Protein ID | OphauB2|2799 |
Gene name | |
Location | Contig_191:23515..24036 |
Strand | - |
Gene length (bp) | 521 |
Transcript length (bp) | 342 |
Coding sequence length (bp) | 342 |
Protein length (aa) | 114 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00253 | Ribosomal_S14 | Ribosomal protein S14p/S29e | 2.5E-19 | 59 | 112 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P10663|RT02_YEAST | 37S ribosomal protein MRP2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP2 PE=1 SV=1 | 14 | 113 | 1.0E-26 |
sp|Q9HF53|RT02_ASHGO | 37S ribosomal protein MRP2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRP2 PE=3 SV=1 | 15 | 113 | 2.0E-25 |
sp|O42859|RT02_SCHPO | Probable 37S ribosomal protein mrp2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp2 PE=3 SV=2 | 15 | 113 | 6.0E-24 |
sp|P26873|RT14_MARPO | Ribosomal protein S14, mitochondrial OS=Marchantia polymorpha GN=RPS14 PE=3 SV=2 | 15 | 113 | 2.0E-15 |
sp|Q2S925|RS14_HAHCH | 30S ribosomal protein S14 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsN PE=3 SV=1 | 21 | 113 | 2.0E-14 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P10663|RT02_YEAST | 37S ribosomal protein MRP2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP2 PE=1 SV=1 | 14 | 113 | 1.0E-26 |
sp|Q9HF53|RT02_ASHGO | 37S ribosomal protein MRP2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRP2 PE=3 SV=1 | 15 | 113 | 2.0E-25 |
sp|O42859|RT02_SCHPO | Probable 37S ribosomal protein mrp2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp2 PE=3 SV=2 | 15 | 113 | 6.0E-24 |
sp|P26873|RT14_MARPO | Ribosomal protein S14, mitochondrial OS=Marchantia polymorpha GN=RPS14 PE=3 SV=2 | 15 | 113 | 2.0E-15 |
sp|Q2S925|RS14_HAHCH | 30S ribosomal protein S14 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsN PE=3 SV=1 | 21 | 113 | 2.0E-14 |
sp|B6IRR9|RS14_RHOCS | 30S ribosomal protein S14 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-14 |
sp|Q47J90|RS14_DECAR | 30S ribosomal protein S14 OS=Dechloromonas aromatica (strain RCB) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-14 |
sp|Q1CY73|RS14_MYXXD | 30S ribosomal protein S14 OS=Myxococcus xanthus (strain DK 1622) GN=rpsN PE=3 SV=1 | 17 | 113 | 1.0E-13 |
sp|Q73TF0|RS14_MYCPA | 30S ribosomal protein S14 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsN PE=3 SV=1 | 17 | 113 | 3.0E-13 |
sp|Q2EEX3|RR14_HELSJ | Plastid 30S ribosomal protein S14 OS=Helicosporidium sp. subsp. Simulium jonesii GN=rps14 PE=3 SV=1 | 19 | 113 | 5.0E-13 |
sp|P05716|RT14_VICFA | Ribosomal protein S14, mitochondrial OS=Vicia faba GN=RPS14 PE=3 SV=2 | 18 | 113 | 6.0E-13 |
sp|Q2GL46|RS14_ANAPZ | 30S ribosomal protein S14 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-13 |
sp|P9WH59|RS14_MYCTU | 30S ribosomal protein S14 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsN PE=3 SV=1 | 16 | 113 | 1.0E-12 |
sp|P9WH58|RS14_MYCTO | 30S ribosomal protein S14 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsN PE=3 SV=1 | 16 | 113 | 1.0E-12 |
sp|A5U481|RS14_MYCTA | 30S ribosomal protein S14 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsN PE=3 SV=1 | 16 | 113 | 1.0E-12 |
sp|A1KKA2|RS14_MYCBP | 30S ribosomal protein S14 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsN PE=3 SV=1 | 16 | 113 | 1.0E-12 |
sp|P66406|RS14_MYCBO | 30S ribosomal protein S14 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsN PE=3 SV=1 | 16 | 113 | 1.0E-12 |
sp|A9CIG1|RS14_AGRFC | 30S ribosomal protein S14 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-12 |
sp|Q5FTZ6|RS14_GLUOX | 30S ribosomal protein S14 OS=Gluconobacter oxydans (strain 621H) GN=rpsN PE=3 SV=1 | 33 | 113 | 2.0E-12 |
sp|A4F7R9|RS14_SACEN | 30S ribosomal protein S14 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpsN PE=3 SV=1 | 16 | 113 | 3.0E-12 |
sp|Q0ANR3|RS14_MARMM | 30S ribosomal protein S14 OS=Maricaulis maris (strain MCS10) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-12 |
sp|Q6B860|RT14_BOVIN | 28S ribosomal protein S14, mitochondrial OS=Bos taurus GN=MRPS14 PE=1 SV=1 | 15 | 113 | 4.0E-12 |
sp|P14875|RT14_OENBE | Ribosomal protein S14, mitochondrial OS=Oenothera berteroana GN=RPS14 PE=3 SV=2 | 15 | 113 | 4.0E-12 |
sp|Q5HAT5|RS14_EHRRW | 30S ribosomal protein S14 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-12 |
sp|Q5FFV3|RS14_EHRRG | 30S ribosomal protein S14 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-12 |
sp|A4XZ77|RS14_PSEMY | 30S ribosomal protein S14 OS=Pseudomonas mendocina (strain ymp) GN=rpsN PE=3 SV=1 | 21 | 113 | 6.0E-12 |
sp|A5WCK3|RS14_PSYWF | 30S ribosomal protein S14 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-12 |
sp|Q9Z6W9|RS14_CHLPN | 30S ribosomal protein S14 OS=Chlamydia pneumoniae GN=rpsN PE=3 SV=1 | 19 | 113 | 8.0E-12 |
sp|O60783|RT14_HUMAN | 28S ribosomal protein S14, mitochondrial OS=Homo sapiens GN=MRPS14 PE=1 SV=1 | 15 | 113 | 8.0E-12 |
sp|Q4K546|RS14_PSEF5 | 30S ribosomal protein S14 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsN PE=3 SV=1 | 21 | 113 | 9.0E-12 |
sp|Q3YRM2|RS14_EHRCJ | 30S ribosomal protein S14 OS=Ehrlichia canis (strain Jake) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-12 |
sp|Q9CR88|RT14_MOUSE | 28S ribosomal protein S14, mitochondrial OS=Mus musculus GN=Mrps14 PE=1 SV=1 | 12 | 113 | 1.0E-11 |
sp|A9IHT7|RS14_BORPD | 30S ribosomal protein S14 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-11 |
sp|A4WVJ5|RS14_RHOS5 | 30S ribosomal protein S14 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-11 |
sp|Q3J5Q9|RS14_RHOS4 | 30S ribosomal protein S14 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-11 |
sp|A3PGM4|RS14_RHOS1 | 30S ribosomal protein S14 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-11 |
sp|Q2GH43|RS14_EHRCR | 30S ribosomal protein S14 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-11 |
sp|Q1QDH3|RS14_PSYCK | 30S ribosomal protein S14 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-11 |
sp|Q4FUE3|RS14_PSYA2 | 30S ribosomal protein S14 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-11 |
sp|A4QCK9|RS14_CORGB | 30S ribosomal protein S14 OS=Corynebacterium glutamicum (strain R) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-11 |
sp|Q28UU1|RS14_JANSC | 30S ribosomal protein S14 OS=Jannaschia sp. (strain CCS1) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-11 |
sp|A4JAQ3|RS14_BURVG | 30S ribosomal protein S14 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-11 |
sp|A1TYL0|RS14_MARHV | 30S ribosomal protein S14 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsN PE=3 SV=1 | 21 | 113 | 3.0E-11 |
sp|A4X8U4|RS14_SALTO | 30S ribosomal protein S14 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpsN PE=3 SV=1 | 23 | 113 | 3.0E-11 |
sp|Q7VTB8|RS14_BORPE | 30S ribosomal protein S14 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-11 |
sp|Q7W2E2|RS14_BORPA | 30S ribosomal protein S14 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-11 |
sp|Q7WRB0|RS14_BORBR | 30S ribosomal protein S14 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-11 |
sp|Q11HR5|RS14_CHESB | 30S ribosomal protein S14 OS=Chelativorans sp. (strain BNC1) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-11 |
sp|B0T2D5|RS14_CAUSK | 30S ribosomal protein S14 OS=Caulobacter sp. (strain K31) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-11 |
sp|Q0BJ33|RS14_BURCM | 30S ribosomal protein S14 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-11 |
sp|B4E5D3|RS14_BURCJ | 30S ribosomal protein S14 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-11 |
sp|A0K3N8|RS14_BURCH | 30S ribosomal protein S14 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-11 |
sp|B1JU35|RS14_BURCC | 30S ribosomal protein S14 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-11 |
sp|Q1BRW1|RS14_BURCA | 30S ribosomal protein S14 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-11 |
sp|B1YRP2|RS14_BURA4 | 30S ribosomal protein S14 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-11 |
sp|A4VHP3|RS14_PSEU5 | 30S ribosomal protein S14 OS=Pseudomonas stutzeri (strain A1501) GN=rpsN PE=3 SV=1 | 21 | 113 | 4.0E-11 |
sp|B5ZYU8|RS14_RHILW | 30S ribosomal protein S14 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-11 |
sp|Q2K9K3|RS14_RHIEC | 30S ribosomal protein S14 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-11 |
sp|B3PWT4|RS14_RHIE6 | 30S ribosomal protein S14 OS=Rhizobium etli (strain CIAT 652) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-11 |
sp|A5EX86|RS14_DICNV | 30S ribosomal protein S14 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsN PE=3 SV=1 | 13 | 113 | 5.0E-11 |
sp|A6W379|RS14_MARMS | 30S ribosomal protein S14 OS=Marinomonas sp. (strain MWYL1) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-11 |
sp|Q82EH4|RS14_STRAW | 30S ribosomal protein S14 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsN PE=3 SV=1 | 17 | 113 | 5.0E-11 |
sp|Q255T5|RS14_CHLFF | 30S ribosomal protein S14 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-11 |
sp|Q5L550|RS14_CHLAB | 30S ribosomal protein S14 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-11 |
sp|A9ADK6|RS14_BURM1 | 30S ribosomal protein S14 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-11 |
sp|Q6MAR9|RS14_PARUW | 30S ribosomal protein S14 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsN PE=3 SV=1 | 35 | 113 | 7.0E-11 |
sp|Q39KF4|RS14_BURL3 | 30S ribosomal protein S14 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-11 |
sp|Q0VSJ0|RS14_ALCBS | 30S ribosomal protein S14 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-11 |
sp|B2UEK6|RS14_RALPJ | 30S ribosomal protein S14 OS=Ralstonia pickettii (strain 12J) GN=rpsN PE=3 SV=1 | 19 | 113 | 8.0E-11 |
sp|A0R550|RS14_MYCS2 | 30S ribosomal protein S14 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsN PE=1 SV=1 | 16 | 113 | 8.0E-11 |
sp|A0PWM0|RS14_MYCUA | 30S ribosomal protein S14 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsN PE=3 SV=1 | 17 | 113 | 9.0E-11 |
sp|B2HKQ2|RS14_MYCMM | 30S ribosomal protein S14 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsN PE=3 SV=1 | 17 | 113 | 9.0E-11 |
sp|Q9A8U0|RS14_CAUCR | 30S ribosomal protein S14 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-11 |
sp|A6T3J1|RS14_JANMA | 30S ribosomal protein S14 OS=Janthinobacterium sp. (strain Marseille) GN=rpsN PE=3 SV=2 | 19 | 113 | 1.0E-10 |
sp|B1MFN1|RS14_MYCA9 | 30S ribosomal protein S14 OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpsN PE=3 SV=1 | 17 | 113 | 1.0E-10 |
sp|Q8XV25|RS14_RALSO | 30S ribosomal protein S14 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-10 |
sp|Q8FR26|RS14_COREF | 30S ribosomal protein S14 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rpsN PE=3 SV=1 | 17 | 113 | 1.0E-10 |
sp|Q2RQX3|RS14_RHORT | 30S ribosomal protein S14 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsN PE=3 SV=1 | 35 | 113 | 1.0E-10 |
sp|Q83GW6|RS14_TROWT | 30S ribosomal protein S14 OS=Tropheryma whipplei (strain Twist) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-10 |
sp|Q83IB4|RS14_TROW8 | 30S ribosomal protein S14 OS=Tropheryma whipplei (strain TW08/27) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-10 |
sp|B3CT18|RS14_ORITI | 30S ribosomal protein S14 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpsN PE=3 SV=1 | 20 | 113 | 2.0E-10 |
sp|Q1MIC8|RS14_RHIL3 | 30S ribosomal protein S14 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|Q8NS17|RS14_CORGL | 30S ribosomal protein S14 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-10 |
sp|Q821V2|RS14_CHLCV | 30S ribosomal protein S14 OS=Chlamydophila caviae (strain GPIC) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|Q2GEC6|RS14_NEOSM | 30S ribosomal protein S14 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|B3EGX7|RS14_CHLL2 | 30S ribosomal protein S14 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|A1WVA9|RS14_HALHL | 30S ribosomal protein S14 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsN PE=3 SV=1 | 16 | 113 | 2.0E-10 |
sp|Q9X8K9|RS14_STRCO | 30S ribosomal protein S14 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-10 |
sp|A1KB14|RS14_AZOSB | 30S ribosomal protein S14 OS=Azoarcus sp. (strain BH72) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|A4SUX4|RS14_POLSQ | 30S ribosomal protein S14 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|B1XSR4|RS14_POLNS | 30S ribosomal protein S14 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|A4G9S5|RS14_HERAR | 30S ribosomal protein S14 OS=Herminiimonas arsenicoxydans GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|B1VFG1|RS14_CORU7 | 30S ribosomal protein S14 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-10 |
sp|Q73H99|RS14_WOLPM | 30S ribosomal protein S14 OS=Wolbachia pipientis wMel GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-10 |
sp|A5CCJ9|RS14_ORITB | 30S ribosomal protein S14 OS=Orientia tsutsugamushi (strain Boryong) GN=rpsN PE=3 SV=1 | 20 | 113 | 3.0E-10 |
sp|B4R8N0|RS14_PHEZH | 30S ribosomal protein S14 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-10 |
sp|B0VQT1|RS14_ACIBS | 30S ribosomal protein S14 OS=Acinetobacter baumannii (strain SDF) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-10 |
sp|A8LM70|RS14_DINSH | 30S ribosomal protein S14 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-10 |
sp|Q6FZD5|RS14_BARQU | 30S ribosomal protein S14 OS=Bartonella quintana (strain Toulouse) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-10 |
sp|B0V6V8|RS14_ACIBY | 30S ribosomal protein S14 OS=Acinetobacter baumannii (strain AYE) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-10 |
sp|A3M971|RS14_ACIBT | 30S ribosomal protein S14 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsN PE=3 SV=2 | 19 | 113 | 4.0E-10 |
sp|B2HZ95|RS14_ACIBC | 30S ribosomal protein S14 OS=Acinetobacter baumannii (strain ACICU) GN=rpsN PE=3 SV=2 | 19 | 113 | 4.0E-10 |
sp|B7IA26|RS14_ACIB5 | 30S ribosomal protein S14 OS=Acinetobacter baumannii (strain AB0057) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-10 |
sp|B7GW15|RS14_ACIB3 | 30S ribosomal protein S14 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-10 |
sp|Q32RS5|RR14_STAPU | 30S ribosomal protein S14, chloroplastic OS=Staurastrum punctulatum GN=rps14 PE=3 SV=1 | 19 | 113 | 4.0E-10 |
sp|B1LWR3|RS14_METRJ | 30S ribosomal protein S14 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-10 |
sp|Q889V8|RS14_PSESM | 30S ribosomal protein S14 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsN PE=3 SV=1 | 21 | 113 | 4.0E-10 |
sp|Q48D49|RS14_PSE14 | 30S ribosomal protein S14 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsN PE=3 SV=1 | 21 | 113 | 4.0E-10 |
sp|A1B040|RS14_PARDP | 30S ribosomal protein S14 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-10 |
sp|A1TGG0|RS14_MYCVP | 30S ribosomal protein S14 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpsN PE=3 SV=1 | 17 | 113 | 5.0E-10 |
sp|Q4ZMQ7|RS14_PSEU2 | 30S ribosomal protein S14 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsN PE=3 SV=1 | 21 | 113 | 5.0E-10 |
sp|P57578|RS14_BUCAI | 30S ribosomal protein S14 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsN PE=3 SV=1 | 32 | 113 | 5.0E-10 |
sp|Q0ABG2|RS14_ALKEH | 30S ribosomal protein S14 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-10 |
sp|B0U0X6|RS14_FRAP2 | 30S ribosomal protein S14 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-10 |
sp|B4S5B5|RS14_PROA2 | 30S ribosomal protein S14 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-10 |
sp|Q3B6E9|RS14_CHLL7 | 30S ribosomal protein S14 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsN PE=3 SV=1 | 69 | 113 | 6.0E-10 |
sp|B2GG86|RS14_KOCRD | 30S ribosomal protein S14 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rpsN PE=3 SV=1 | 17 | 113 | 6.0E-10 |
sp|A0Q4J6|RS14_FRATN | 30S ribosomal protein S14 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-10 |
sp|B0UHV6|RS14_METS4 | 30S ribosomal protein S14 OS=Methylobacterium sp. (strain 4-46) GN=rpsN PE=3 SV=1 | 17 | 113 | 7.0E-10 |
sp|B4RT41|RS14_ALTMD | 30S ribosomal protein S14 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-10 |
sp|A4SCS2|RS14_CHLPM | 30S ribosomal protein S14 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsN PE=3 SV=1 | 69 | 113 | 8.0E-10 |
sp|P49387|RT14_BRANA | Ribosomal protein S14, mitochondrial OS=Brassica napus GN=RPS14 PE=3 SV=1 | 21 | 113 | 8.0E-10 |
sp|Q6G2X8|RS14_BARHE | 30S ribosomal protein S14 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsN PE=3 SV=1 | 32 | 113 | 9.0E-10 |
sp|Q92QF7|RS14_RHIME | 30S ribosomal protein S14 OS=Rhizobium meliloti (strain 1021) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-10 |
sp|P46752|RT14_PROWI | Ribosomal protein S14, mitochondrial OS=Prototheca wickerhamii GN=RPS14 PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q3API6|RS14_CHLCH | 30S ribosomal protein S14 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsN PE=3 SV=1 | 69 | 113 | 1.0E-09 |
sp|Q98N44|RS14_RHILO | 30S ribosomal protein S14 OS=Rhizobium loti (strain MAFF303099) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|A6U872|RS14_SINMW | 30S ribosomal protein S14 OS=Sinorhizobium medicae (strain WSM419) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q06SD8|RR14_STIHE | 30S ribosomal protein S14, chloroplastic OS=Stigeoclonium helveticum GN=rps14 PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q3BWX0|RS14_XANC5 | 30S ribosomal protein S14 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q489A0|RS14_COLP3 | 30S ribosomal protein S14 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-09 |
sp|Q9HWE8|RS14_PSEAE | 30S ribosomal protein S14 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsN PE=3 SV=1 | 21 | 113 | 1.0E-09 |
sp|Q02T67|RS14_PSEAB | 30S ribosomal protein S14 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsN PE=3 SV=1 | 21 | 113 | 1.0E-09 |
sp|B7V657|RS14_PSEA8 | 30S ribosomal protein S14 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsN PE=3 SV=1 | 21 | 113 | 1.0E-09 |
sp|A6UZK1|RS14_PSEA7 | 30S ribosomal protein S14 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsN PE=3 SV=2 | 21 | 113 | 1.0E-09 |
sp|Q16AD1|RS14_ROSDO | 30S ribosomal protein S14 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q31IW9|RS14_THICR | 30S ribosomal protein S14 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q7NQG5|RS14_CHRVO | 30S ribosomal protein S14 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-09 |
sp|Q4FLN1|RS14_PELUB | 30S ribosomal protein S14 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsN PE=3 SV=1 | 35 | 113 | 1.0E-09 |
sp|Q134U2|RS14_RHOPS | 30S ribosomal protein S14 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q6NIC8|RS14_CORDI | 30S ribosomal protein S14 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-09 |
sp|A3Q995|RS14_SHELP | 30S ribosomal protein S14 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-09 |
sp|B4SBW0|RS14_PELPB | 30S ribosomal protein S14 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsN PE=3 SV=1 | 67 | 113 | 2.0E-09 |
sp|B3QR76|RS14_CHLP8 | 30S ribosomal protein S14 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsN PE=3 SV=1 | 69 | 113 | 2.0E-09 |
sp|A8IAQ2|RS14_AZOC5 | 30S ribosomal protein S14 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsN PE=3 SV=2 | 19 | 113 | 2.0E-09 |
sp|Q6F7S5|RS14_ACIAD | 30S ribosomal protein S14 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|A4IZS1|RS14_FRATW | 30S ribosomal protein S14 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q5NHV5|RS14_FRATT | 30S ribosomal protein S14 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q0BNR4|RS14_FRATO | 30S ribosomal protein S14 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|B2SDX2|RS14_FRATM | 30S ribosomal protein S14 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q2A5F7|RS14_FRATH | 30S ribosomal protein S14 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q14JA7|RS14_FRAT1 | 30S ribosomal protein S14 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q9PE63|RS14_XYLFA | 30S ribosomal protein S14 OS=Xylella fastidiosa (strain 9a5c) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-09 |
sp|Q2IXP7|RS14_RHOP2 | 30S ribosomal protein S14 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsN PE=3 SV=1 | 25 | 113 | 3.0E-09 |
sp|Q8KAI5|RS14_CHLTE | 30S ribosomal protein S14 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q5QXX1|RS14_IDILO | 30S ribosomal protein S14 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsN PE=3 SV=1 | 20 | 113 | 3.0E-09 |
sp|A4SSZ3|RS14_AERS4 | 30S ribosomal protein S14 OS=Aeromonas salmonicida (strain A449) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-09 |
sp|B3R7F5|RS14_CUPTR | 30S ribosomal protein S14 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q0K632|RS14_CUPNH | 30S ribosomal protein S14 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q2SU40|RS14_BURTA | 30S ribosomal protein S14 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q63Q24|RS14_BURPS | 30S ribosomal protein S14 OS=Burkholderia pseudomallei (strain K96243) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|A3NEG6|RS14_BURP6 | 30S ribosomal protein S14 OS=Burkholderia pseudomallei (strain 668) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q3JMS6|RS14_BURP1 | 30S ribosomal protein S14 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|A3P0A0|RS14_BURP0 | 30S ribosomal protein S14 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|A1V890|RS14_BURMS | 30S ribosomal protein S14 OS=Burkholderia mallei (strain SAVP1) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q62GL8|RS14_BURMA | 30S ribosomal protein S14 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|A2S7I9|RS14_BURM9 | 30S ribosomal protein S14 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|A3MRW7|RS14_BURM7 | 30S ribosomal protein S14 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-09 |
sp|Q5GWU8|RS14_XANOR | 30S ribosomal protein S14 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|B2SQS3|RS14_XANOP | 30S ribosomal protein S14 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|Q2NZZ8|RS14_XANOM | 30S ribosomal protein S14 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|Q7CLU4|RS14_XANCP | 30S ribosomal protein S14 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|B0RU69|RS14_XANCB | 30S ribosomal protein S14 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|Q4URF2|RS14_XANC8 | 30S ribosomal protein S14 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|Q8NL05|RS14_XANAC | 30S ribosomal protein S14 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|B2FQJ7|RS14_STRMK | 30S ribosomal protein S14 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|Q4JTZ7|RS14_CORJK | 30S ribosomal protein S14 OS=Corynebacterium jeikeium (strain K411) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-09 |
sp|Q46WF7|RS14_CUPPJ | 30S ribosomal protein S14 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|Q87E69|RS14_XYLFT | 30S ribosomal protein S14 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|B0U5L2|RS14_XYLFM | 30S ribosomal protein S14 OS=Xylella fastidiosa (strain M12) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|B2I8I2|RS14_XYLF2 | 30S ribosomal protein S14 OS=Xylella fastidiosa (strain M23) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|A7IPQ7|RS14_XANP2 | 30S ribosomal protein S14 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|B0KK80|RS14_PSEPG | 30S ribosomal protein S14 OS=Pseudomonas putida (strain GB-1) GN=rpsN PE=3 SV=1 | 21 | 113 | 5.0E-09 |
sp|B3GZ24|RS14_ACTP7 | 30S ribosomal protein S14 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|A3N370|RS14_ACTP2 | 30S ribosomal protein S14 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|Q21M45|RS14_SACD2 | 30S ribosomal protein S14 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|Q5LW45|RS14_RUEPO | 30S ribosomal protein S14 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|Q88QM2|RS14_PSEPK | 30S ribosomal protein S14 OS=Pseudomonas putida (strain KT2440) GN=rpsN PE=3 SV=1 | 21 | 113 | 5.0E-09 |
sp|A5VXR0|RS14_PSEP1 | 30S ribosomal protein S14 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsN PE=3 SV=1 | 21 | 113 | 5.0E-09 |
sp|B3EP48|RS14_CHLPB | 30S ribosomal protein S14 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-09 |
sp|A8G1D5|RS14_SHESH | 30S ribosomal protein S14 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsN PE=3 SV=1 | 32 | 113 | 6.0E-09 |
sp|Q6LVA3|RS14_PHOPR | 30S ribosomal protein S14 OS=Photobacterium profundum GN=rpsN PE=3 SV=1 | 32 | 113 | 6.0E-09 |
sp|Q1H4M4|RS14_METFK | 30S ribosomal protein S14 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-09 |
sp|Q2W2K4|RS14_MAGSA | 30S ribosomal protein S14 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-09 |
sp|Q9GGE2|RR14_CHLRE | 30S ribosomal protein S14, chloroplastic OS=Chlamydomonas reinhardtii GN=rps14 PE=1 SV=1 | 19 | 113 | 6.0E-09 |
sp|Q0BUN7|RS14_GRABC | 30S ribosomal protein S14 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsN PE=3 SV=2 | 33 | 113 | 6.0E-09 |
sp|B0BSU4|RS14_ACTPJ | 30S ribosomal protein S14 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-09 |
sp|B1KMX0|RS14_SHEWM | 30S ribosomal protein S14 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsN PE=3 SV=1 | 32 | 113 | 6.0E-09 |
sp|A5UHU4|RS14_HAEIG | 30S ribosomal protein S14 OS=Haemophilus influenzae (strain PittGG) GN=rpsN PE=3 SV=1 | 32 | 113 | 7.0E-09 |
sp|A4T5Z9|RS14_MYCGI | 30S ribosomal protein S14 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsN PE=3 SV=1 | 16 | 113 | 7.0E-09 |
sp|B2JI52|RS14_BURP8 | 30S ribosomal protein S14 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-09 |
sp|Q1LI50|RS14_CUPMC | 30S ribosomal protein S14 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-09 |
sp|Q2YAY4|RS14_NITMU | 30S ribosomal protein S14 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-09 |
sp|B1JAJ9|RS14_PSEPW | 30S ribosomal protein S14 OS=Pseudomonas putida (strain W619) GN=rpsN PE=3 SV=1 | 21 | 113 | 8.0E-09 |
sp|B1JIX4|RS14_YERPY | 30S ribosomal protein S14 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|Q664T4|RS14_YERPS | 30S ribosomal protein S14 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|A4TH05|RS14_YERPP | 30S ribosomal protein S14 OS=Yersinia pestis (strain Pestoides F) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|Q1CCV7|RS14_YERPN | 30S ribosomal protein S14 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|A9R908|RS14_YERPG | 30S ribosomal protein S14 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|Q8ZJ99|RS14_YERPE | 30S ribosomal protein S14 OS=Yersinia pestis GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|B2K524|RS14_YERPB | 30S ribosomal protein S14 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|Q1C2W0|RS14_YERPA | 30S ribosomal protein S14 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|A7FNM1|RS14_YERP3 | 30S ribosomal protein S14 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|B8CNE6|RS14_SHEPW | 30S ribosomal protein S14 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|A0KF34|RS14_AERHH | 30S ribosomal protein S14 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsN PE=3 SV=1 | 32 | 113 | 8.0E-09 |
sp|Q6CZY3|RS14_PECAS | 30S ribosomal protein S14 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsN PE=3 SV=1 | 32 | 113 | 9.0E-09 |
sp|A1BJ21|RS14_CHLPD | 30S ribosomal protein S14 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsN PE=3 SV=1 | 69 | 113 | 1.0E-08 |
sp|Q8YQ66|RS14_NOSS1 | 30S ribosomal protein S14 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q3MCD2|RS14_ANAVT | 30S ribosomal protein S14 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q9PLD4|RS14_CHLMU | 30S ribosomal protein S14 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|A9BG05|RS14Z_PETMO | 30S ribosomal protein S14 type Z OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-08 |
sp|O84792|RS14_CHLTR | 30S ribosomal protein S14 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|B0BAP2|RS14_CHLTB | 30S ribosomal protein S14 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q3KKQ5|RS14_CHLTA | 30S ribosomal protein S14 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|B0B913|RS14_CHLT2 | 30S ribosomal protein S14 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|B0UX27|RS14_HISS2 | 30S ribosomal protein S14 OS=Histophilus somni (strain 2336) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q0I149|RS14_HAES1 | 30S ribosomal protein S14 OS=Haemophilus somnus (strain 129Pt) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q0I092|RS14_SHESR | 30S ribosomal protein S14 OS=Shewanella sp. (strain MR-7) GN=rpsN PE=3 SV=1 | 20 | 113 | 1.0E-08 |
sp|Q0HNS4|RS14_SHESM | 30S ribosomal protein S14 OS=Shewanella sp. (strain MR-4) GN=rpsN PE=3 SV=1 | 20 | 113 | 1.0E-08 |
sp|A7N9T8|RS14_FRATF | 30S ribosomal protein S14 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q5P319|RS14_AROAE | 30S ribosomal protein S14 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|B2IK75|RS14_BEII9 | 30S ribosomal protein S14 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-08 |
sp|A7HWS4|RS14_PARL1 | 30S ribosomal protein S14 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsN PE=3 SV=1 | 45 | 113 | 1.0E-08 |
sp|B1Z780|RS14_METPB | 30S ribosomal protein S14 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q3AV45|RS14_SYNS9 | 30S ribosomal protein S14 OS=Synechococcus sp. (strain CC9902) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q0BYC7|RS14_HYPNA | 30S ribosomal protein S14 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|Q0AII3|RS14_NITEC | 30S ribosomal protein S14 OS=Nitrosomonas eutropha (strain C91) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-08 |
sp|P0A4B2|RS14Z_AQUPY | 30S ribosomal protein S14 type Z OS=Aquifex pyrophilus GN=rpsZ PE=3 SV=1 | 73 | 113 | 1.0E-08 |
sp|P0A4B1|RS14Z_AQUAE | 30S ribosomal protein S14 type Z OS=Aquifex aeolicus (strain VF5) GN=rpsZ PE=3 SV=1 | 73 | 113 | 1.0E-08 |
sp|A1JS18|RS14_YERE8 | 30S ribosomal protein S14 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|Q5E8A1|RS14_VIBF1 | 30S ribosomal protein S14 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|A9W4S7|RS14_METEP | 30S ribosomal protein S14 OS=Methylobacterium extorquens (strain PA1) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|A8GYY9|RS14_SHEPA | 30S ribosomal protein S14 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsN PE=3 SV=1 | 20 | 113 | 2.0E-08 |
sp|B0TLZ9|RS14_SHEHH | 30S ribosomal protein S14 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsN PE=3 SV=1 | 20 | 113 | 2.0E-08 |
sp|B1ZND5|RS14_OPITP | 30S ribosomal protein S14 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|Q07KN1|RS14_RHOP5 | 30S ribosomal protein S14 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|A9WTS9|RS14_RENSM | 30S ribosomal protein S14 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|B3CN39|RS14_WOLPP | 30S ribosomal protein S14 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|Q0P3K4|RR14_OSTTA | 30S ribosomal protein S14, chloroplastic OS=Ostreococcus tauri GN=rps14 PE=3 SV=1 | 33 | 113 | 2.0E-08 |
sp|A8FI98|RS14_BACP2 | 30S ribosomal protein S14 OS=Bacillus pumilus (strain SAFR-032) GN=rpsN PE=3 SV=1 | 70 | 113 | 2.0E-08 |
sp|A6VLK1|RS14_ACTSZ | 30S ribosomal protein S14 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsN PE=3 SV=1 | 20 | 113 | 2.0E-08 |
sp|B4SKX6|RS14_STRM5 | 30S ribosomal protein S14 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|A7N0J0|RS14_VIBCB | 30S ribosomal protein S14 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsN PE=3 SV=1 | 16 | 113 | 2.0E-08 |
sp|Q1IFV3|RS14_PSEE4 | 30S ribosomal protein S14 OS=Pseudomonas entomophila (strain L48) GN=rpsN PE=3 SV=1 | 21 | 113 | 2.0E-08 |
sp|Q2JVE0|RS14_SYNJA | 30S ribosomal protein S14 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|Q8A489|RS14_BACTN | 30S ribosomal protein S14 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|A1AVL3|RS14_RUTMC | 30S ribosomal protein S14 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|Q2NQN5|RS14_SODGM | 30S ribosomal protein S14 OS=Sodalis glossinidius (strain morsitans) GN=rpsN PE=3 SV=1 | 34 | 113 | 2.0E-08 |
sp|Q8M9Y2|RR14_CHAGL | 30S ribosomal protein S14, chloroplastic OS=Chaetosphaeridium globosum GN=rps14 PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|Q64NM1|RS14_BACFR | 30S ribosomal protein S14 OS=Bacteroides fragilis (strain YCH46) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|Q5L8C2|RS14_BACFN | 30S ribosomal protein S14 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|A0T0B3|RR14_PHATC | 30S ribosomal protein S14, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps14 PE=3 SV=1 | 40 | 113 | 2.0E-08 |
sp|Q65QW8|RS14_MANSM | 30S ribosomal protein S14 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsN PE=3 SV=1 | 20 | 113 | 2.0E-08 |
sp|Q15X60|RS14_PSEA6 | 30S ribosomal protein S14 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-08 |
sp|Q2JLR9|RS14_SYNJB | 30S ribosomal protein S14 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-08 |
sp|Q12G90|RS14_POLSJ | 30S ribosomal protein S14 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsN PE=3 SV=1 | 39 | 113 | 2.0E-08 |
sp|A9H3M4|RS14_GLUDA | 30S ribosomal protein S14 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsN PE=3 SV=2 | 33 | 113 | 2.0E-08 |
sp|B3QBW7|RS14_RHOPT | 30S ribosomal protein S14 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-08 |
sp|Q3IJJ8|RS14_PSEHT | 30S ribosomal protein S14 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsN PE=3 SV=1 | 16 | 113 | 3.0E-08 |
sp|A1TJT0|RS14_ACIAC | 30S ribosomal protein S14 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsN PE=3 SV=1 | 39 | 113 | 3.0E-08 |
sp|A1S231|RS14_SHEAM | 30S ribosomal protein S14 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-08 |
sp|B0CAI0|RS14_ACAM1 | 30S ribosomal protein S14 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-08 |
sp|A5FZV2|RS14_ACICJ | 30S ribosomal protein S14 OS=Acidiphilium cryptum (strain JF-5) GN=rpsN PE=3 SV=1 | 39 | 113 | 3.0E-08 |
sp|C6C198|RS14Z_DESAD | 30S ribosomal protein S14 type Z OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsZ PE=3 SV=1 | 74 | 113 | 3.0E-08 |
sp|P44381|RS14_HAEIN | 30S ribosomal protein S14 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsN PE=3 SV=2 | 29 | 113 | 3.0E-08 |
sp|A5UDT4|RS14_HAEIE | 30S ribosomal protein S14 OS=Haemophilus influenzae (strain PittEE) GN=rpsN PE=3 SV=2 | 29 | 113 | 3.0E-08 |
sp|Q4QMA8|RS14_HAEI8 | 30S ribosomal protein S14 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsN PE=3 SV=1 | 29 | 113 | 3.0E-08 |
sp|P32976|RR14_CHLVU | 30S ribosomal protein S14, chloroplastic OS=Chlorella vulgaris GN=rps14 PE=3 SV=1 | 19 | 113 | 3.0E-08 |
sp|Q13TI3|RS14_BURXL | 30S ribosomal protein S14 OS=Burkholderia xenovorans (strain LB400) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-08 |
sp|B2T738|RS14_BURPP | 30S ribosomal protein S14 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-08 |
sp|Q1KVT9|RR14_ACUOB | 30S ribosomal protein S14, chloroplastic OS=Acutodesmus obliquus GN=rps14 PE=3 SV=1 | 69 | 113 | 3.0E-08 |
sp|A1REC7|RS14_SHESW | 30S ribosomal protein S14 OS=Shewanella sp. (strain W3-18-1) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-08 |
sp|A4YBX0|RS14_SHEPC | 30S ribosomal protein S14 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-08 |
sp|Q211G1|RS14_RHOPB | 30S ribosomal protein S14 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsN PE=3 SV=1 | 25 | 113 | 3.0E-08 |
sp|Q89J97|RS14_BRADU | 30S ribosomal protein S14 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-08 |
sp|A8M6L1|RS14_SALAI | 30S ribosomal protein S14 OS=Salinispora arenicola (strain CNS-205) GN=rpsN PE=3 SV=1 | 32 | 113 | 3.0E-08 |
sp|Q1GK16|RS14_RUEST | 30S ribosomal protein S14 OS=Ruegeria sp. (strain TM1040) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-08 |
sp|B6EPT8|RS14_ALISL | 30S ribosomal protein S14 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsN PE=3 SV=1 | 32 | 113 | 4.0E-08 |
sp|Q85CU9|RR14_ANTFO | 30S ribosomal protein S14, chloroplastic OS=Anthoceros formosae GN=rps14 PE=2 SV=1 | 19 | 113 | 4.0E-08 |
sp|A1VJ28|RS14_POLNA | 30S ribosomal protein S14 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsN PE=3 SV=1 | 53 | 113 | 4.0E-08 |
sp|Q87T00|RS14_VIBPA | 30S ribosomal protein S14 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsN PE=3 SV=1 | 32 | 113 | 4.0E-08 |
sp|A9KWB5|RS14_SHEB9 | 30S ribosomal protein S14 OS=Shewanella baltica (strain OS195) GN=rpsN PE=3 SV=1 | 20 | 113 | 4.0E-08 |
sp|A6WHU1|RS14_SHEB8 | 30S ribosomal protein S14 OS=Shewanella baltica (strain OS185) GN=rpsN PE=3 SV=1 | 20 | 113 | 4.0E-08 |
sp|A3DA59|RS14_SHEB5 | 30S ribosomal protein S14 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsN PE=3 SV=1 | 20 | 113 | 4.0E-08 |
sp|Q493J5|RS14_BLOPB | 30S ribosomal protein S14 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsN PE=3 SV=1 | 32 | 113 | 4.0E-08 |
sp|Q089P1|RS14_SHEFN | 30S ribosomal protein S14 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsN PE=3 SV=1 | 20 | 113 | 4.0E-08 |
sp|Q1QN17|RS14_NITHX | 30S ribosomal protein S14 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsN PE=3 SV=1 | 25 | 113 | 4.0E-08 |
sp|B5FG22|RS14_VIBFM | 30S ribosomal protein S14 OS=Vibrio fischeri (strain MJ11) GN=rpsN PE=3 SV=1 | 32 | 113 | 4.0E-08 |
sp|Q9CL43|RS14_PASMU | 30S ribosomal protein S14 OS=Pasteurella multocida (strain Pm70) GN=rpsN PE=3 SV=1 | 20 | 113 | 4.0E-08 |
sp|Q5ZYN0|RS14_LEGPH | 30S ribosomal protein S14 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsN PE=3 SV=2 | 19 | 113 | 4.0E-08 |
sp|Q5X846|RS14_LEGPA | 30S ribosomal protein S14 OS=Legionella pneumophila (strain Paris) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-08 |
sp|Q1WQV0|RS14_LACS1 | 30S ribosomal protein S14 OS=Lactobacillus salivarius (strain UCC118) GN=rpsN PE=3 SV=1 | 54 | 113 | 4.0E-08 |
sp|B2X201|RR14_OEDCA | 30S ribosomal protein S14, chloroplastic OS=Oedogonium cardiacum GN=rps14 PE=3 SV=1 | 19 | 113 | 4.0E-08 |
sp|Q8K963|RS14_BUCAP | 30S ribosomal protein S14 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsN PE=3 SV=1 | 32 | 113 | 4.0E-08 |
sp|B4F1J7|RS14_PROMH | 30S ribosomal protein S14 OS=Proteus mirabilis (strain HI4320) GN=rpsN PE=3 SV=1 | 20 | 113 | 4.0E-08 |
sp|Q8D1Z9|RS14_WIGBR | 30S ribosomal protein S14 OS=Wigglesworthia glossinidia brevipalpis GN=rpsN PE=3 SV=1 | 31 | 113 | 5.0E-08 |
sp|Q7MYG4|RS14_PHOLL | 30S ribosomal protein S14 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsN PE=3 SV=1 | 20 | 113 | 5.0E-08 |
sp|O31587|RS14B_BACSU | Alternate 30S ribosomal protein S14 OS=Bacillus subtilis (strain 168) GN=rpsN2 PE=1 SV=1 | 72 | 113 | 5.0E-08 |
sp|A1WKA3|RS14_VEREI | 30S ribosomal protein S14 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-08 |
sp|Q8MFA1|RR14_PHYPA | 30S ribosomal protein S14, chloroplastic OS=Physcomitrella patens subsp. patens GN=rps14 PE=2 SV=1 | 19 | 113 | 5.0E-08 |
sp|A4WFB5|RS14_ENT38 | 30S ribosomal protein S14 OS=Enterobacter sp. (strain 638) GN=rpsN PE=3 SV=1 | 34 | 113 | 5.0E-08 |
sp|B2J6L1|RS14_NOSP7 | 30S ribosomal protein S14 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-08 |
sp|Q1R0G2|RS14_CHRSD | 30S ribosomal protein S14 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsN PE=3 SV=1 | 32 | 113 | 5.0E-08 |
sp|A7MPG2|RS14_CROS8 | 30S ribosomal protein S14 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsN PE=3 SV=1 | 32 | 113 | 5.0E-08 |
sp|Q9ZAE6|RS14Z_THEMA | 30S ribosomal protein S14 type Z OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsZ PE=3 SV=1 | 74 | 113 | 5.0E-08 |
sp|Q3SLN6|RS14_THIDA | 30S ribosomal protein S14 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-08 |
sp|Q7MPH5|RS14_VIBVY | 30S ribosomal protein S14 OS=Vibrio vulnificus (strain YJ016) GN=rpsN PE=3 SV=1 | 32 | 113 | 6.0E-08 |
sp|Q8DE53|RS14_VIBVU | 30S ribosomal protein S14 OS=Vibrio vulnificus (strain CMCP6) GN=rpsN PE=3 SV=1 | 32 | 113 | 6.0E-08 |
sp|Q9MUR6|RR14_MESVI | 30S ribosomal protein S14, chloroplastic OS=Mesostigma viride GN=rps14 PE=3 SV=1 | 19 | 113 | 6.0E-08 |
sp|Q5WZJ9|RS14_LEGPL | 30S ribosomal protein S14 OS=Legionella pneumophila (strain Lens) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-08 |
sp|A9BRW4|RS14_DELAS | 30S ribosomal protein S14 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsN PE=3 SV=1 | 39 | 113 | 6.0E-08 |
sp|Q8EK56|RS14_SHEON | 30S ribosomal protein S14 OS=Shewanella oneidensis (strain MR-1) GN=rpsN PE=3 SV=1 | 20 | 113 | 6.0E-08 |
sp|Q7TU67|RS14_PROMP | 30S ribosomal protein S14 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsN PE=3 SV=1 | 19 | 113 | 7.0E-08 |
sp|B1LBM7|RS14Z_THESQ | 30S ribosomal protein S14 type Z OS=Thermotoga sp. (strain RQ2) GN=rpsZ PE=3 SV=1 | 74 | 113 | 7.0E-08 |
sp|A5IM96|RS14Z_THEP1 | 30S ribosomal protein S14 type Z OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsZ PE=3 SV=1 | 74 | 113 | 7.0E-08 |
sp|B9K899|RS14Z_THENN | 30S ribosomal protein S14 type Z OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsZ PE=3 SV=1 | 74 | 113 | 7.0E-08 |
sp|Q7VQD5|RS14_BLOFL | 30S ribosomal protein S14 OS=Blochmannia floridanus GN=rpsN PE=3 SV=1 | 32 | 113 | 7.0E-08 |
sp|A1W321|RS14_ACISJ | 30S ribosomal protein S14 OS=Acidovorax sp. (strain JS42) GN=rpsN PE=3 SV=1 | 39 | 113 | 7.0E-08 |
sp|Q057B7|RS14_BUCCC | 30S ribosomal protein S14 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsN PE=3 SV=1 | 20 | 113 | 7.0E-08 |
sp|A0KRN7|RS14_SHESA | 30S ribosomal protein S14 OS=Shewanella sp. (strain ANA-3) GN=rpsN PE=3 SV=1 | 20 | 113 | 8.0E-08 |
sp|Q9TLQ7|RR14_CYACA | 30S ribosomal protein S14, chloroplastic OS=Cyanidium caldarium GN=rps14 PE=3 SV=1 | 32 | 113 | 8.0E-08 |
sp|A5ELL4|RS14_BRASB | 30S ribosomal protein S14 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsN PE=3 SV=1 | 22 | 113 | 8.0E-08 |
sp|Q7TUT2|RS14_PROMM | 30S ribosomal protein S14 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-08 |
sp|Q4UMR6|RS14_RICFE | 30S ribosomal protein S14 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-08 |
sp|A6W4N6|RS14_KINRD | 30S ribosomal protein S14 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpsN PE=3 SV=1 | 16 | 113 | 9.0E-08 |
sp|B3PK50|RS14_CELJU | 30S ribosomal protein S14 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsN PE=3 SV=1 | 19 | 113 | 9.0E-08 |
sp|Q3J8S7|RS14_NITOC | 30S ribosomal protein S14 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsN PE=3 SV=1 | 13 | 113 | 9.0E-08 |
sp|Q9TL38|RR14_NEPOL | 30S ribosomal protein S14, chloroplastic OS=Nephroselmis olivacea GN=rps14 PE=3 SV=1 | 19 | 113 | 9.0E-08 |
sp|Q9KNZ7|RS14_VIBCH | 30S ribosomal protein S14 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsN PE=3 SV=1 | 20 | 113 | 9.0E-08 |
sp|A5F553|RS14_VIBC3 | 30S ribosomal protein S14 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsN PE=3 SV=1 | 20 | 113 | 9.0E-08 |
sp|B2UP25|RS14_AKKM8 | 30S ribosomal protein S14 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpsN PE=3 SV=1 | 35 | 113 | 9.0E-08 |
sp|Q7UN07|RS14Z_RHOBA | 30S ribosomal protein S14 type Z OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsZ PE=3 SV=1 | 69 | 113 | 1.0E-07 |
sp|A8GPD7|RS14_RICAH | 30S ribosomal protein S14 OS=Rickettsia akari (strain Hartford) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-07 |
sp|Q1GPB2|RS14_SPHAL | 30S ribosomal protein S14 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsN PE=3 SV=1 | 39 | 113 | 1.0E-07 |
sp|B1XNV8|RS14_SYNP2 | 30S ribosomal protein S14 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-07 |
sp|P0C5Y1|RT14_DICCI | Ribosomal protein S14, mitochondrial OS=Dictyostelium citrinum GN=mrps14 PE=3 SV=1 | 21 | 113 | 1.0E-07 |
sp|A0K1X4|RS14_ARTS2 | 30S ribosomal protein S14 OS=Arthrobacter sp. (strain FB24) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-07 |
sp|Q0S4Z1|RS14_RHOJR | 30S ribosomal protein S14 OS=Rhodococcus jostii (strain RHA1) GN=rpsN PE=3 SV=1 | 16 | 113 | 1.0E-07 |
sp|P66409|RS14_SALTY | 30S ribosomal protein S14 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsN PE=3 SV=2 | 32 | 113 | 1.0E-07 |
sp|P66410|RS14_SALTI | 30S ribosomal protein S14 OS=Salmonella typhi GN=rpsN PE=3 SV=2 | 32 | 113 | 1.0E-07 |
sp|B4TXC9|RS14_SALSV | 30S ribosomal protein S14 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A9MSY5|RS14_SALPB | 30S ribosomal protein S14 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B4SUS7|RS14_SALNS | 30S ribosomal protein S14 OS=Salmonella newport (strain SL254) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B4TKK2|RS14_SALHS | 30S ribosomal protein S14 OS=Salmonella heidelberg (strain SL476) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B5FJK1|RS14_SALDC | 30S ribosomal protein S14 OS=Salmonella dublin (strain CT_02021853) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q57J45|RS14_SALCH | 30S ribosomal protein S14 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B5F7T2|RS14_SALA4 | 30S ribosomal protein S14 OS=Salmonella agona (strain SL483) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B5BGX3|RS14_SALPK | 30S ribosomal protein S14 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q5PIU6|RS14_SALPA | 30S ribosomal protein S14 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q5NQ52|RS14_ZYMMO | 30S ribosomal protein S14 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-07 |
sp|P66400|RS14_BRUSU | 30S ribosomal protein S14 OS=Brucella suis biovar 1 (strain 1330) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B0CH19|RS14_BRUSI | 30S ribosomal protein S14 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A5VQZ3|RS14_BRUO2 | 30S ribosomal protein S14 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|P66399|RS14_BRUME | 30S ribosomal protein S14 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A9M5N7|RS14_BRUC2 | 30S ribosomal protein S14 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q57CS1|RS14_BRUAB | 30S ribosomal protein S14 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B2S666|RS14_BRUA1 | 30S ribosomal protein S14 OS=Brucella abortus (strain S19) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B3QYD7|RS14_CHLT3 | 30S ribosomal protein S14 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-07 |
sp|Q21QN6|RS14_RHOFT | 30S ribosomal protein S14 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsN PE=3 SV=2 | 19 | 113 | 1.0E-07 |
sp|Q2YRA8|RS14_BRUA2 | 30S ribosomal protein S14 OS=Brucella abortus (strain 2308) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A1USQ7|RS14_BARBK | 30S ribosomal protein S14 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsN PE=3 SV=1 | 42 | 113 | 1.0E-07 |
sp|Q8RIG9|RS14_FUSNN | 30S ribosomal protein S14 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsN PE=3 SV=1 | 40 | 113 | 1.0E-07 |
sp|Q12SU6|RS14_SHEDO | 30S ribosomal protein S14 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q3YWV2|RS14_SHISS | 30S ribosomal protein S14 OS=Shigella sonnei (strain Ss046) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|P0AG62|RS14_SHIFL | 30S ribosomal protein S14 OS=Shigella flexneri GN=rpsN PE=3 SV=2 | 32 | 113 | 1.0E-07 |
sp|Q0SZZ5|RS14_SHIF8 | 30S ribosomal protein S14 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q32B44|RS14_SHIDS | 30S ribosomal protein S14 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q31VW9|RS14_SHIBS | 30S ribosomal protein S14 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B2U2S5|RS14_SHIB3 | 30S ribosomal protein S14 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B7LRS3|RS14_ESCF3 | 30S ribosomal protein S14 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|Q1R621|RS14_ECOUT | 30S ribosomal protein S14 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B1LHC1|RS14_ECOSM | 30S ribosomal protein S14 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B6I221|RS14_ECOSE | 30S ribosomal protein S14 OS=Escherichia coli (strain SE11) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B7NDS8|RS14_ECOLU | 30S ribosomal protein S14 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|P0AG59|RS14_ECOLI | 30S ribosomal protein S14 OS=Escherichia coli (strain K12) GN=rpsN PE=1 SV=2 | 32 | 113 | 1.0E-07 |
sp|B1IPZ2|RS14_ECOLC | 30S ribosomal protein S14 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|P0AG60|RS14_ECOL6 | 30S ribosomal protein S14 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsN PE=3 SV=2 | 32 | 113 | 1.0E-07 |
sp|Q0TCF4|RS14_ECOL5 | 30S ribosomal protein S14 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A1AGJ6|RS14_ECOK1 | 30S ribosomal protein S14 OS=Escherichia coli O1:K1 / APEC GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A8A5B2|RS14_ECOHS | 30S ribosomal protein S14 OS=Escherichia coli O9:H4 (strain HS) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B1X6F9|RS14_ECODH | 30S ribosomal protein S14 OS=Escherichia coli (strain K12 / DH10B) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B7NLM6|RS14_ECO7I | 30S ribosomal protein S14 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|B5YTM8|RS14_ECO5E | 30S ribosomal protein S14 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|P0AG61|RS14_ECO57 | 30S ribosomal protein S14 OS=Escherichia coli O157:H7 GN=rpsN PE=3 SV=2 | 32 | 113 | 1.0E-07 |
sp|B7MCS2|RS14_ECO45 | 30S ribosomal protein S14 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A7ZSJ6|RS14_ECO24 | 30S ribosomal protein S14 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsN PE=3 SV=1 | 32 | 113 | 1.0E-07 |
sp|A6X0D1|RS14_OCHA4 | 30S ribosomal protein S14 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-07 |
sp|A2SLE4|RS14_METPP | 30S ribosomal protein S14 OS=Methylibium petroleiphilum (strain PM1) GN=rpsN PE=3 SV=1 | 39 | 113 | 2.0E-07 |
sp|A9BBJ6|RS14_PROM4 | 30S ribosomal protein S14 OS=Prochlorococcus marinus (strain MIT 9211) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|B7M1M1|RS14_ECO8A | 30S ribosomal protein S14 OS=Escherichia coli O8 (strain IAI1) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-07 |
sp|B1VRF5|RS14_STRGG | 30S ribosomal protein S14 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsN PE=3 SV=1 | 17 | 113 | 2.0E-07 |
sp|Q5GSV7|RS14_WOLTR | 30S ribosomal protein S14 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|Q9ZCR8|RS14_RICPR | 30S ribosomal protein S14 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|A8GT56|RS14_RICRS | 30S ribosomal protein S14 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|B0BUP7|RS14_RICRO | 30S ribosomal protein S14 OS=Rickettsia rickettsii (strain Iowa) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|A8F2D4|RS14_RICM5 | 30S ribosomal protein S14 OS=Rickettsia massiliae (strain Mtu5) GN=rpsN PE=3 SV=2 | 19 | 113 | 2.0E-07 |
sp|Q92GX9|RS14_RICCN | 30S ribosomal protein S14 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|Q89A79|RS14_BUCBP | 30S ribosomal protein S14 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-07 |
sp|B3EUL0|RS14_AMOA5 | 30S ribosomal protein S14 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsN PE=3 SV=1 | 35 | 113 | 2.0E-07 |
sp|A1VEA3|RS14Z_DESVV | 30S ribosomal protein S14 type Z OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsZ PE=3 SV=1 | 74 | 113 | 2.0E-07 |
sp|Q72CG7|RS14Z_DESVH | 30S ribosomal protein S14 type Z OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsZ PE=3 SV=1 | 74 | 113 | 2.0E-07 |
sp|A5V5Y9|RS14_SPHWW | 30S ribosomal protein S14 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|P52858|RS14_SYNP6 | 30S ribosomal protein S14 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|A6KYI2|RS14_BACV8 | 30S ribosomal protein S14 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsN PE=3 SV=1 | 32 | 113 | 2.0E-07 |
sp|Q32RQ2|RR14_ZYGCR | 30S ribosomal protein S14, chloroplastic OS=Zygnema circumcarinatum GN=rps14 PE=3 SV=1 | 16 | 113 | 2.0E-07 |
sp|A5GN18|RS14_SYNPW | 30S ribosomal protein S14 OS=Synechococcus sp. (strain WH7803) GN=rpsN PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|A0T0S2|RR14_THAPS | 30S ribosomal protein S14, chloroplastic OS=Thalassiosira pseudonana GN=rps14 PE=3 SV=1 | 19 | 113 | 2.0E-07 |
sp|A7Z2Q4|RS14_BACMF | 30S ribosomal protein S14 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsN PE=3 SV=1 | 72 | 113 | 2.0E-07 |
sp|Q8CSP8|RS14_STAES | 30S ribosomal protein S14 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsN PE=3 SV=1 | 33 | 113 | 2.0E-07 |
sp|Q5HPK6|RS14_STAEQ | 30S ribosomal protein S14 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsN PE=3 SV=1 | 33 | 113 | 2.0E-07 |
sp|Q319U5|RS14_PROM9 | 30S ribosomal protein S14 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-07 |
sp|Q1LTC5|RS14_BAUCH | 30S ribosomal protein S14 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsN PE=3 SV=1 | 34 | 113 | 3.0E-07 |
sp|C5CGI9|RS14Z_KOSOT | 30S ribosomal protein S14 type Z OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsZ PE=3 SV=1 | 74 | 113 | 3.0E-07 |
sp|Q1RHN4|RS14_RICBR | 30S ribosomal protein S14 OS=Rickettsia bellii (strain RML369-C) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-07 |
sp|A8GVC7|RS14_RICB8 | 30S ribosomal protein S14 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsN PE=3 SV=1 | 19 | 113 | 3.0E-07 |
sp|B8DNA9|RS14Z_DESVM | 30S ribosomal protein S14 type Z OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsZ PE=3 SV=1 | 74 | 113 | 3.0E-07 |
sp|Q6GH70|RS14_STAAR | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain MRSA252) GN=rpsN PE=3 SV=1 | 70 | 113 | 3.0E-07 |
sp|B8IYK4|RS14Z_DESDA | 30S ribosomal protein S14 type Z OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpsZ PE=3 SV=1 | 74 | 113 | 3.0E-07 |
sp|P66416|RS14_STAAW | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain MW2) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|Q6G9M2|RS14_STAAS | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain MSSA476) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|P66415|RS14_STAAN | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain N315) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|P66414|RS14_STAAM | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|A6QGN8|RS14_STAAE | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain Newman) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|Q5HG84|RS14_STAAC | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain COL) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|Q2YXT0|RS14_STAAB | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|A5ISL8|RS14_STAA9 | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain JH9) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|Q2FYU5|RS14_STAA8 | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|Q2FH97|RS14_STAA3 | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain USA300) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|A6U1F6|RS14_STAA2 | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain JH1) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|A7X1Z0|RS14_STAA1 | 30S ribosomal protein S14 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsN PE=3 SV=1 | 69 | 113 | 4.0E-07 |
sp|Q4L645|RS14_STAHJ | 30S ribosomal protein S14 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsN PE=3 SV=1 | 70 | 113 | 4.0E-07 |
sp|Q65M53|RS14_BACLD | 30S ribosomal protein S14 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsN PE=3 SV=1 | 72 | 113 | 4.0E-07 |
sp|Q2N9C4|RS14_ERYLH | 30S ribosomal protein S14 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsN PE=3 SV=1 | 19 | 113 | 4.0E-07 |
sp|A5CXL7|RS14_VESOH | 30S ribosomal protein S14 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsN PE=3 SV=1 | 21 | 113 | 4.0E-07 |
sp|Q85FM1|RR14_ADICA | 30S ribosomal protein S14, chloroplastic OS=Adiantum capillus-veneris GN=rps14 PE=2 SV=2 | 19 | 113 | 4.0E-07 |
sp|Q19V89|RR14_CHLAT | 30S ribosomal protein S14, chloroplastic OS=Chlorokybus atmophyticus GN=rps14 PE=3 SV=1 | 69 | 113 | 5.0E-07 |
sp|Q68W91|RS14_RICTY | 30S ribosomal protein S14 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsN PE=3 SV=1 | 19 | 113 | 5.0E-07 |
sp|A8F4S4|RS14Z_PSELT | 30S ribosomal protein S14 type Z OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsZ PE=3 SV=1 | 74 | 113 | 5.0E-07 |
sp|B2V7K0|RS14Z_SULSY | 30S ribosomal protein S14 type Z OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsZ PE=3 SV=1 | 69 | 113 | 5.0E-07 |
sp|O21035|RT14_DICDI | Ribosomal protein S14, mitochondrial OS=Dictyostelium discoideum GN=mrps14 PE=3 SV=1 | 21 | 113 | 5.0E-07 |
sp|Q2S3Q1|RS14_SALRD | 30S ribosomal protein S14 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsN PE=3 SV=1 | 69 | 113 | 5.0E-07 |
sp|B6JEX8|RS14_OLICO | 30S ribosomal protein S14 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsN PE=3 SV=1 | 42 | 113 | 6.0E-07 |
sp|A2BSA6|RS14_PROMS | 30S ribosomal protein S14 OS=Prochlorococcus marinus (strain AS9601) GN=rpsN PE=3 SV=1 | 19 | 113 | 6.0E-07 |
sp|P15759|RT14_PARTE | Ribosomal protein S14, mitochondrial OS=Paramecium tetraurelia GN=RPS14 PE=3 SV=1 | 25 | 113 | 6.0E-07 |
sp|B5YDV6|RS14Z_DICT6 | 30S ribosomal protein S14 type Z OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpsZ PE=3 SV=1 | 74 | 113 | 7.0E-07 |
sp|A1RB22|RS14_ARTAT | 30S ribosomal protein S14 OS=Arthrobacter aurescens (strain TC1) GN=rpsN PE=3 SV=1 | 17 | 113 | 7.0E-07 |
sp|P48944|RS14_SYNY3 | 30S ribosomal protein S14 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsN PE=3 SV=1 | 19 | 113 | 8.0E-07 |
sp|A9MN61|RS14_SALAR | 30S ribosomal protein S14 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsN PE=3 SV=1 | 32 | 113 | 9.0E-07 |
sp|C4XLY6|RS14Z_DESMR | 30S ribosomal protein S14 type Z OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpsZ PE=3 SV=1 | 69 | 113 | 9.0E-07 |
sp|A2T331|RR14_ANGEV | 30S ribosomal protein S14, chloroplastic OS=Angiopteris evecta GN=rps14 PE=3 SV=1 | 19 | 113 | 9.0E-07 |
sp|Q4L8A1|RS14Z_STAHJ | 30S ribosomal protein S14 type Z OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|P66413|RS14Z_STAAW | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain MW2) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|A8Z344|RS14Z_STAAT | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q6G784|RS14Z_STAAS | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain MSSA476) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q6GEJ6|RS14Z_STAAR | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain MRSA252) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|P66412|RS14Z_STAAN | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain N315) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|P66411|RS14Z_STAAM | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|A6QJ79|RS14Z_STAAE | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain Newman) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q5HDX1|RS14Z_STAAC | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain COL) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q2YYL0|RS14Z_STAAB | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsZ PE=3 SV=2 | 74 | 113 | 1.0E-06 |
sp|A5IV21|RS14Z_STAA9 | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain JH9) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q2FW19|RS14Z_STAA8 | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsZ PE=3 SV=2 | 74 | 113 | 1.0E-06 |
sp|Q2FEQ2|RS14Z_STAA3 | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain USA300) GN=rpsZ PE=3 SV=2 | 74 | 113 | 1.0E-06 |
sp|A6U3W2|RS14Z_STAA2 | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain JH1) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|A7X5E4|RS14Z_STAA1 | 30S ribosomal protein S14 type Z OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|P11538|RR14_EUGGR | 30S ribosomal protein S14, chloroplastic OS=Euglena gracilis GN=rps14 PE=3 SV=1 | 72 | 113 | 1.0E-06 |
sp|B5XNA6|RS14_KLEP3 | 30S ribosomal protein S14 OS=Klebsiella pneumoniae (strain 342) GN=rpsN PE=3 SV=1 | 34 | 113 | 1.0E-06 |
sp|B1Y8C4|RS14_LEPCP | 30S ribosomal protein S14 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|Q82X78|RS14_NITEU | 30S ribosomal protein S14 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|Q6N4U6|RS14_RHOPA | 30S ribosomal protein S14 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsN PE=1 SV=3 | 19 | 113 | 1.0E-06 |
sp|A5GRD9|RS14_SYNR3 | 30S ribosomal protein S14 OS=Synechococcus sp. (strain RCC307) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|A8EZK3|RS14_RICCK | 30S ribosomal protein S14 OS=Rickettsia canadensis (strain McKiel) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|Q46JM8|RS14_PROMT | 30S ribosomal protein S14 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|Q8CRH3|RS14Z_STAES | 30S ribosomal protein S14 type Z OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q5HM12|RS14Z_STAEQ | 30S ribosomal protein S14 type Z OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|P66420|RS14_STRR6 | 30S ribosomal protein S14 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-06 |
sp|B2IS53|RS14_STRPS | 30S ribosomal protein S14 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-06 |
sp|P66419|RS14_STRPN | 30S ribosomal protein S14 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-06 |
sp|B1I8L1|RS14_STRPI | 30S ribosomal protein S14 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-06 |
sp|B5E6G8|RS14_STRP4 | 30S ribosomal protein S14 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-06 |
sp|Q04MM3|RS14_STRP2 | 30S ribosomal protein S14 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsN PE=3 SV=1 | 70 | 113 | 1.0E-06 |
sp|B8E1E6|RS14Z_DICTD | 30S ribosomal protein S14 type Z OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q7VKE6|RS14_HAEDU | 30S ribosomal protein S14 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|B9DM34|RS14Z_STACT | 30S ribosomal protein S14 type Z OS=Staphylococcus carnosus (strain TM300) GN=rpsZ PE=3 SV=1 | 74 | 113 | 1.0E-06 |
sp|Q3SSV3|RS14_NITWN | 30S ribosomal protein S14 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsN PE=3 SV=1 | 42 | 113 | 1.0E-06 |
sp|A2C411|RS14_PROM1 | 30S ribosomal protein S14 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsN PE=3 SV=1 | 19 | 113 | 1.0E-06 |
sp|P06370|RR14_MARPO | 30S ribosomal protein S14, chloroplastic OS=Marchantia polymorpha GN=rps14 PE=3 SV=1 | 19 | 113 | 2.0E-06 |
sp|Q5WAR0|RS14_BACSK | 30S ribosomal protein S14 OS=Bacillus clausii (strain KSM-K16) GN=rpsN PE=3 SV=1 | 60 | 113 | 2.0E-06 |
sp|Q10ZE2|RS14_TRIEI | 30S ribosomal protein S14 OS=Trichodesmium erythraeum (strain IMS101) GN=rpsN PE=3 SV=1 | 52 | 113 | 2.0E-06 |
sp|Q7MTM6|RS14_PORGI | 30S ribosomal protein S14 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsN PE=3 SV=1 | 69 | 113 | 2.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003735 | structural constituent of ribosome | Yes |
GO:0005840 | ribosome | Yes |
GO:0006412 | translation | Yes |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0110165 | cellular anatomical entity | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0043226 | organelle | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0043603 | cellular amide metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0009059 | macromolecule biosynthetic process | No |
GO:0005198 | structural molecule activity | No |
GO:0008150 | biological_process | No |
GO:0005575 | cellular_component | No |
GO:0043170 | macromolecule metabolic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0043604 | amide biosynthetic process | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0044237 | cellular metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0009987 | cellular process | No |
GO:0044238 | primary metabolic process | No |
GO:0009058 | biosynthetic process | No |
GO:0043043 | peptide biosynthetic process | No |
GO:0019538 | protein metabolic process | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:0043229 | intracellular organelle | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >OphauB2|2799 MSMFRAKRLDLGCIINTRIVRDHTKRMTYYSYETERQALRYIVRNTTLSPRLRAEAQLQLASMHCYTRSTPIKNR CIMGGRGRAVFRAFKLSRFVFRMEALAGNLPGVRKGSW* |
Coding | >OphauB2|2799 ATGTCCATGTTTCGGGCCAAGCGCCTCGACCTGGGCTGCATTATCAACACTCGTATTGTTCGCGACCATACAAAG CGCATGACCTATTACTCGTACGAGACGGAGAGACAAGCGTTGCGCTACATTGTTCGCAACACGACGCTGTCTCCG CGTCTGCGTGCCGAAGCCCAACTGCAGCTCGCGTCAATGCACTGCTATACTCGCTCCACACCAATAAAGAATCGC TGCATCATGGGCGGTAGAGGGCGCGCCGTTTTTAGAGCCTTTAAATTATCCCGATTTGTTTTCAGAATGGAAGCC TTGGCTGGAAACTTGCCAGGCGTTAGAAAGGGCAGTTGGTAG |
Transcript | >OphauB2|2799 ATGTCCATGTTTCGGGCCAAGCGCCTCGACCTGGGCTGCATTATCAACACTCGTATTGTTCGCGACCATACAAAG CGCATGACCTATTACTCGTACGAGACGGAGAGACAAGCGTTGCGCTACATTGTTCGCAACACGACGCTGTCTCCG CGTCTGCGTGCCGAAGCCCAACTGCAGCTCGCGTCAATGCACTGCTATACTCGCTCCACACCAATAAAGAATCGC TGCATCATGGGCGGTAGAGGGCGCGCCGTTTTTAGAGCCTTTAAATTATCCCGATTTGTTTTCAGAATGGAAGCC TTGGCTGGAAACTTGCCAGGCGTTAGAAAGGGCAGTTGGTAG |
Gene | >OphauB2|2799 ATGTCCATGTTTCGGGCCAAGCGCCTCGACCTGGGCTGCATTATCAACACTCGTATTGTTCGCGACCATACAAAG CGCATGACCTATTACTCGTACGAGACGGAGAGGTGAAGCTTTCCCCCCGCCTATGCTCTCTCCTTGCAAGTCGCT CGAGGCGCCTTGGAAACGTCTAGCCACTCGAGGTGCCTTGGAGACGTCCACTTGGACTAATTTAAACCAGACAAG CGTTGCGCTACATTGTTCGCAACACGACGCTGTCTCCGCGTCTGCGTGCCGAAGCCCAACTGCAGCTCGCGTCAA TGCACTGCTATACTCGCTCCACACCAATAAAGAATCGCTGCATCATGGGCGGTAGAGGGCGCGCCGTTTTTAGAG CCTTTAAATTATCCCGAGTAAGGCCCTGGTAGCAAGCTGTGCCTCATGGCCAGAAACAAGACGGAGCTACTGACA CGATGTAGTTTGTTTTCAGAATGGAAGCCTTGGCTGGAAACTTGCCAGGCGTTAGAAAGGGCAGTTGGTAG |