Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2796
Gene name
LocationContig_191:15599..17176
Strand-
Gene length (bp)1577
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 2.0E-40 54 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 1 326 2.0E-95
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 15 262 2.0E-73
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 18 266 3.0E-65
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 23 267 2.0E-57
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 6 266 4.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 1 326 2.0E-95
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 15 262 2.0E-73
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 18 266 3.0E-65
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 23 267 2.0E-57
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 6 266 4.0E-55
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 23 284 2.0E-32
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 65 271 6.0E-26
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 88 258 9.0E-25
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 87 222 2.0E-22
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 67 243 3.0E-20
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 54 243 2.0E-19
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 42 221 5.0E-11
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 42 221 8.0E-11
sp|Q8LF99|XTH6_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2 65 231 2.0E-10
sp|Q9ZV40|XTH21_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 21 OS=Arabidopsis thaliana GN=XTH21 PE=2 SV=1 88 232 3.0E-09
sp|Q38857|XTH22_ARATH Xyloglucan endotransglucosylase/hydrolase protein 22 OS=Arabidopsis thaliana GN=XTH22 PE=1 SV=1 88 263 3.0E-09
sp|Q9FI31|XTH20_ARATH Xyloglucan endotransglucosylase/hydrolase protein 20 OS=Arabidopsis thaliana GN=XTH20 PE=2 SV=1 88 240 7.0E-09
sp|Q38907|XTH25_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2 82 232 1.0E-08
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 66 207 1.0E-08
sp|Q9M0D2|XTH18_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 18 OS=Arabidopsis thaliana GN=XTH18 PE=2 SV=1 88 277 1.0E-08
sp|Q9M0D1|XTH19_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1 88 240 2.0E-08
sp|O80803|XTH17_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 17 OS=Arabidopsis thaliana GN=XTH17 PE=1 SV=1 88 240 2.0E-08
sp|Q8LER3|XTH7_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2 61 218 2.0E-08
sp|Q9FKL9|XTH12_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1 88 232 3.0E-08
sp|P35694|XTH2_SOYBN Xyloglucan endotransglucosylase/hydrolase 2 OS=Glycine max PE=2 SV=1 88 243 5.0E-08
sp|Q9SVV2|XTH26_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 26 OS=Arabidopsis thaliana GN=XTH26 PE=2 SV=1 82 250 7.0E-08
sp|P24806|XTH24_ARATH Xyloglucan endotransglucosylase/hydrolase protein 24 OS=Arabidopsis thaliana GN=XTH24 PE=1 SV=2 88 231 7.0E-08
sp|Q38911|XTH15_ARATH Xyloglucan endotransglucosylase/hydrolase protein 15 OS=Arabidopsis thaliana GN=XTH15 PE=1 SV=1 88 232 1.0E-07
sp|Q41638|XTHA_PHAAN Xyloglucan endotransglucosylase/hydrolase protein A OS=Phaseolus angularis GN=XTHA PE=1 SV=1 88 256 1.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 42 207 3.0E-07
sp|Q9FKL8|XTH13_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 13 OS=Arabidopsis thaliana GN=XTH13 PE=3 SV=1 88 232 3.0E-07
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 58 207 4.0E-07
sp|Q38910|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1 88 232 4.0E-07
sp|Q8LG58|XTH16_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 16 OS=Arabidopsis thaliana GN=XTH16 PE=2 SV=2 88 232 5.0E-07
sp|P27051|GUB_BACLI Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1 77 221 6.0E-07
sp|Q9SV60|XTH2_ARATH Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana GN=XTH2 PE=2 SV=1 91 220 8.0E-07
sp|Q8LDS2|XTH27_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 27 OS=Arabidopsis thaliana GN=XTH27 PE=2 SV=2 2 228 9.0E-07
sp|Q39857|XTH1_SOYBN Xyloglucan endotransglucosylase/hydrolase 1 OS=Glycine max GN=XTH1 PE=2 SV=2 88 257 1.0E-06
sp|Q9ZSU4|XTH14_ARATH Xyloglucan endotransglucosylase/hydrolase protein 14 OS=Arabidopsis thaliana GN=XTH14 PE=1 SV=1 88 218 1.0E-06
sp|Q39099|XTH4_ARATH Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana GN=XTH4 PE=1 SV=1 88 286 2.0E-06
sp|Q41542|XTH_WHEAT Probable xyloglucan endotransglucosylase/hydrolase OS=Triticum aestivum GN=XTH PE=2 SV=1 82 257 2.0E-06
sp|P93349|XTH_TOBAC Probable xyloglucan endotransglucosylase/hydrolase protein OS=Nicotiana tabacum GN=XTH PE=2 SV=1 61 232 4.0E-06
sp|Q6YDN9|XTH_BRAOB Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1 88 286 5.0E-06
sp|Q38909|XTH28_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 28 OS=Arabidopsis thaliana GN=XTH28 PE=2 SV=1 117 242 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 295 317 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2796
MLSRLLALLPLLGLVAAQVHTDCNPLENSKCPANPAFGTDHVFNFNSTPSSELWETTAGVVKFDQDGAAAFTINK
QGDSPTIRTRFYFFFGRTEIWLKVAPGVGIVSSMMWLSDVLDEVDWEFLGSNSSFASTNFFGKGRQDYRNGGWHP
MTGMQDDFHNYTTTWTRDQIDWYIDDKLVRTLKAAEANGTSNYPQTPMRMSIGIWAGGDPSLPEGTRKWAGGNTD
YGAGPYTMLVQKAQVTDYSTGREYKYGDQSGSWESIQVTEGNSTALDALNKKPEKSINEKWNDLPSGAKIGVYSG
AAAVAAIAFGSLLFYFIRQRRRGAREARAAEQRAQTERLEMERFQGKAKFDNRGGGSADSFTEYAPEYDSRTNTL
RKGDADSYHVPETTTSSPLANASWGAGAVRRSSAVAAPPRIVSPAPSHGFDFGVPPSPGLPPSPGLPPSGPLPSL
PMGAGRNGYSPLRTTSAAAGPPRPSPGPAAGRNFSDMQPSRRGPI*
Coding >OphauB2|2796
ATGCTGAGCCGTCTGCTTGCTCTGCTGCCGCTGCTGGGCCTGGTGGCTGCCCAGGTGCATACCGACTGCAATCCC
CTTGAAAACTCAAAGTGTCCTGCAAACCCTGCCTTTGGAACCGACCACGTCTTCAACTTCAACTCGACCCCTTCG
TCGGAGCTGTGGGAGACGACGGCGGGCGTGGTCAAGTTTGACCAGGATGGCGCCGCCGCCTTTACCATTAACAAG
CAGGGCGACTCGCCCACCATTCGCACTCGCTTCTACTTCTTCTTTGGCCGCACCGAGATTTGGCTCAAGGTTGCT
CCCGGCGTCGGCATTGTCTCGTCCATGATGTGGCTGAGCGATGTCCTGGACGAGGTTGACTGGGAGTTTCTCGGC
TCCAATTCATCCTTTGCCTCGACAAACTTTTTTGGCAAGGGCCGCCAGGATTATCGCAATGGCGGCTGGCATCCC
ATGACGGGCATGCAGGACGACTTTCACAACTACACCACCACTTGGACCCGCGACCAAATCGACTGGTACATTGAC
GACAAGCTGGTTCGGACGCTCAAGGCTGCCGAGGCCAATGGCACAAGCAACTACCCGCAGACGCCAATGCGCATG
AGCATCGGCATCTGGGCTGGCGGCGATCCATCGCTTCCAGAAGGCACTCGCAAGTGGGCTGGTGGAAACACGGAC
TATGGCGCTGGTCCCTATACCATGCTGGTGCAAAAGGCGCAGGTGACGGACTATAGCACCGGCCGCGAGTACAAG
TATGGCGACCAGTCGGGCAGCTGGGAGAGCATCCAAGTGACTGAAGGCAACTCGACTGCTCTCGACGCCCTCAAC
AAGAAGCCGGAAAAGTCCATCAACGAAAAGTGGAACGATCTTCCGTCGGGAGCCAAGATTGGCGTCTACAGCGGC
GCCGCTGCCGTTGCTGCCATTGCCTTTGGCTCGCTGCTCTTTTACTTTATCCGCCAGCGCCGCCGTGGTGCCCGC
GAGGCCCGTGCCGCCGAACAGCGTGCGCAGACTGAGCGCCTCGAGATGGAACGTTTCCAGGGCAAGGCCAAGTTT
GACAATCGTGGCGGCGGCAGTGCAGACAGCTTCACCGAGTACGCGCCCGAGTACGATTCGCGGACCAATACCTTG
CGCAAAGGCGACGCTGATTCCTACCACGTGCCCGAGACGACAACGTCGAGTCCTCTGGCCAACGCTTCGTGGGGT
GCCGGTGCTGTCAGGCGCAGCTCGGCCGTTGCAGCTCCACCACGCATAGTCAGCCCGGCTCCTTCGCACGGCTTC
GACTTTGGAGTGCCGCCCAGTCCCGGTCTGCCGCCCAGCCCAGGCCTCCCGCCGTCGGGGCCGCTGCCCTCGCTG
CCCATGGGTGCTGGACGCAATGGCTACTCACCGCTGCGCACCACGTCGGCGGCTGCCGGTCCACCACGCCCAAGC
CCTGGTCCAGCGGCAGGGCGCAACTTTAGCGACATGCAGCCAAGTCGCAGAGGCCCAATCTAG
Transcript >OphauB2|2796
ATGCTGAGCCGTCTGCTTGCTCTGCTGCCGCTGCTGGGCCTGGTGGCTGCCCAGGTGCATACCGACTGCAATCCC
CTTGAAAACTCAAAGTGTCCTGCAAACCCTGCCTTTGGAACCGACCACGTCTTCAACTTCAACTCGACCCCTTCG
TCGGAGCTGTGGGAGACGACGGCGGGCGTGGTCAAGTTTGACCAGGATGGCGCCGCCGCCTTTACCATTAACAAG
CAGGGCGACTCGCCCACCATTCGCACTCGCTTCTACTTCTTCTTTGGCCGCACCGAGATTTGGCTCAAGGTTGCT
CCCGGCGTCGGCATTGTCTCGTCCATGATGTGGCTGAGCGATGTCCTGGACGAGGTTGACTGGGAGTTTCTCGGC
TCCAATTCATCCTTTGCCTCGACAAACTTTTTTGGCAAGGGCCGCCAGGATTATCGCAATGGCGGCTGGCATCCC
ATGACGGGCATGCAGGACGACTTTCACAACTACACCACCACTTGGACCCGCGACCAAATCGACTGGTACATTGAC
GACAAGCTGGTTCGGACGCTCAAGGCTGCCGAGGCCAATGGCACAAGCAACTACCCGCAGACGCCAATGCGCATG
AGCATCGGCATCTGGGCTGGCGGCGATCCATCGCTTCCAGAAGGCACTCGCAAGTGGGCTGGTGGAAACACGGAC
TATGGCGCTGGTCCCTATACCATGCTGGTGCAAAAGGCGCAGGTGACGGACTATAGCACCGGCCGCGAGTACAAG
TATGGCGACCAGTCGGGCAGCTGGGAGAGCATCCAAGTGACTGAAGGCAACTCGACTGCTCTCGACGCCCTCAAC
AAGAAGCCGGAAAAGTCCATCAACGAAAAGTGGAACGATCTTCCGTCGGGAGCCAAGATTGGCGTCTACAGCGGC
GCCGCTGCCGTTGCTGCCATTGCCTTTGGCTCGCTGCTCTTTTACTTTATCCGCCAGCGCCGCCGTGGTGCCCGC
GAGGCCCGTGCCGCCGAACAGCGTGCGCAGACTGAGCGCCTCGAGATGGAACGTTTCCAGGGCAAGGCCAAGTTT
GACAATCGTGGCGGCGGCAGTGCAGACAGCTTCACCGAGTACGCGCCCGAGTACGATTCGCGGACCAATACCTTG
CGCAAAGGCGACGCTGATTCCTACCACGTGCCCGAGACGACAACGTCGAGTCCTCTGGCCAACGCTTCGTGGGGT
GCCGGTGCTGTCAGGCGCAGCTCGGCCGTTGCAGCTCCACCACGCATAGTCAGCCCGGCTCCTTCGCACGGCTTC
GACTTTGGAGTGCCGCCCAGTCCCGGTCTGCCGCCCAGCCCAGGCCTCCCGCCGTCGGGGCCGCTGCCCTCGCTG
CCCATGGGTGCTGGACGCAATGGCTACTCACCGCTGCGCACCACGTCGGCGGCTGCCGGTCCACCACGCCCAAGC
CCTGGTCCAGCGGCAGGGCGCAACTTTAGCGACATGCAGCCAAGTCGCAGAGGCCCAATCTAG
Gene >OphauB2|2796
ATGCTGAGCCGTCTGCTTGCTCTGCTGCCGCTGCTGGGCCTGGTGGCTGCCCAGGTGCATACCGACTGCAATCCC
CTTGAAAACTCAAAGTGTCCTGCAAACCCTGCCTTTGGAACCGACCACGTCTTCAACTTCAACTCGACCCCTTCG
TCGGAGCTGTGGGAGACGACGGCGGGCGTGGTCAAGTTTGACCAGGATGGCGCCGCCGCCTTTACCATTAACAAG
CAGGGCGACTCGCCCACCATTCGCACTCGCTTCTACTTCTTCTTTGGCCGCACCGAGATTTGGCTCAAGGTTGCT
CCCGGCGTCGGCATTGTCTCGTCCATGATGTGGCTGAGCGATGTCCTGGACGAGGTTGACTGGGAGTTTCTCGGC
TCCAATTCATCCTTTGCCTCGACAAACTTTTTTGGCAAGGGCCGCCAGGATTATCGCAATGGCGGCTGGCATCCC
ATGACGGGCATGCAGGACGACTTTCACAACTACACCACCACTTGGACCCGCGACCAAATCGACTGGTACATTGAC
GACAAGCTGGTTCGGACGCTCAAGGCTGCCGAGGCCAATGGCACAAGCAACTACCCGCAGACGCCAATGCGCATG
AGCATCGGCATCTGGGCTGGCGGCGATCCATCGCTTCCAGAAGGCACTCGCAAGTGGGCTGGTGGAAACACGGAC
TATGGCGCTGGTCCCTATACCATGCTGGTGCAAAAGGCGCAGGTGACGGACTATAGCACCGGCCGCGAGTACAAG
TATGGCGACCAGTCGGGCAGCTGGGAGAGCATCCAAGTGACTGAGTAAGTCGAAAATGCCACCTCGTGCTTGACA
AGGCGTCGGCTTCTGTGCTTGGCAAAAGGCAATGCTAACCAACCCCTTCTTCCAACAGAGGCAACTCGACTGCTC
TCGACGCCCTCAACAAGAAGCCGGAAAAGTCCATCAACGAAAAGTGGAACGATCTTCCGTCGGGAGCCAAGATTG
GCGTCTACAGCGGCGCCGCTGCCGTTGCTGCCATTGCCTTTGGCTCGCTGCTCTTTTACTTTATCCGCCAGCGCC
GCCGTGGTGCCCGCGAGGCCCGTGCCGCCGAACAGCGTGCGCAGACTGAGCGCCTCGAGATGGAACGTTTCCAGG
GCAAGGCCAAGTTTGACAATCGTGGCGGCGGCAGTGCAGACAGCTTCACCGAGTACGCGCCCGAGTACGATTCGC
GGACCAATACCTTGCGCAAAGGCGACGCTGATTCCTACCACGTGCCCGAGACGACAACGTCGAGTCCTCTGGCCA
ACGCTTCGTGGGGTGCCGGTGCTGTCAGGCGCAGCTCGGCCGTTGCAGCTCCACCACGCATAGTCAGCCCGGCTC
CTTCGCACGGCTTCGACTTTGGAGTGCCGCCCAGTCCCGGTCTGCCGCCCAGCCCAGGCCTCCCGCCGTCGGGGC
CGCTGCCCTCGCTGCCCATGGGTGCTGGACGCAATGGCTACTCACCGCTGCGCACCACGTCGGCGGCTGCCGGTC
CACCACGCCCAAGCCCTGGTCCAGCGGCAGGGCGCAACTTTAGCGACATGCAGCCAAGTCGCAGAGGCCCAATCT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail