Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2794
Gene name
LocationContig_191:10854..12754
Strand-
Gene length (bp)1900
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00463 ICL Isocitrate lyase family 1.6E-182 68 594
PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase 2.8E-11 147 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 35 595 0.0E+00
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 30 595 0.0E+00
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 55 594 0.0E+00
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 57 594 0.0E+00
sp|A8NR45|ACEA_COPC7 Isocitrate lyase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACU-7 PE=3 SV=1 58 594 1.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C8V9Y5|ACEB_EMENI Methylisocitrate lyase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mclA PE=1 SV=1 35 595 0.0E+00
sp|G9NNY7|ACEB_HYPAI 2-methylisocitrate lyase, mitochondrial OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) GN=mcl PE=3 SV=1 30 595 0.0E+00
sp|Q12031|ACEB_YEAST Mitochondrial 2-methylisocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL2 PE=1 SV=1 55 594 0.0E+00
sp|Q6BZP5|ACEB_YARLI 2-methylisocitrate lyase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F31999g PE=1 SV=1 57 594 0.0E+00
sp|A8NR45|ACEA_COPC7 Isocitrate lyase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACU-7 PE=3 SV=1 58 594 1.0E-178
sp|P45457|ACEA2_SOYBN Isocitrate lyase 2 (Fragment) OS=Glycine max GN=ICL2 PE=2 SV=1 64 594 4.0E-176
sp|P25248|ACEA_BRANA Isocitrate lyase OS=Brassica napus PE=2 SV=1 59 594 4.0E-175
sp|O13439|ACEA_COPCI Isocitrate lyase OS=Coprinopsis cinerea GN=ACU-7 PE=3 SV=1 58 594 6.0E-175
sp|P15479|ACEA_RICCO Isocitrate lyase OS=Ricinus communis PE=2 SV=1 59 594 1.0E-174
sp|P45456|ACEA1_SOYBN Isocitrate lyase 1 (Fragment) OS=Glycine max GN=ICL1 PE=2 SV=1 64 594 3.0E-174
sp|P17069|ACEA_GOSHI Isocitrate lyase OS=Gossypium hirsutum PE=2 SV=1 59 594 4.0E-172
sp|Q9SE26|ACEA_DENCR Isocitrate lyase OS=Dendrobium crumenatum GN=ICL PE=2 SV=1 59 594 6.0E-172
sp|P28297|ACEA_ARATH Isocitrate lyase OS=Arabidopsis thaliana GN=ICL PE=1 SV=2 59 594 1.0E-171
sp|P93110|ACEA_CUCMA Isocitrate lyase OS=Cucurbita maxima PE=2 SV=1 59 594 4.0E-171
sp|P49296|ACEA_CUCSA Isocitrate lyase OS=Cucumis sativus PE=3 SV=1 59 594 4.0E-168
sp|P49297|ACEA_SOLLC Isocitrate lyase OS=Solanum lycopersicum PE=2 SV=1 59 595 2.0E-166
sp|Q6Z6M4|ACEA_ORYSJ Isocitrate lyase OS=Oryza sativa subsp. japonica GN=ICL PE=1 SV=1 59 594 1.0E-165
sp|Q43097|ACEA_PINTA Isocitrate lyase OS=Pinus taeda GN=ICL 8 PE=2 SV=1 59 595 3.0E-165
sp|P28298|ACEA_EMENI Isocitrate lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuD PE=1 SV=3 57 594 3.0E-162
sp|Q6T267|ACEA_ASPFU Isocitrate lyase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=icl1 PE=3 SV=2 57 594 4.0E-161
sp|Q96TP5|ACEA_COCIM Isocitrate lyase OS=Coccidioides immitis (strain RS) GN=ICL1 PE=2 SV=2 57 594 6.0E-160
sp|Q96WZ5|ACEA_TALMA Isocitrate lyase OS=Talaromyces marneffei GN=icl1 PE=3 SV=1 59 594 1.0E-159
sp|Q86ZF1|ACEA_LEPMC Isocitrate lyase OS=Leptosphaeria maculans GN=ICL1 PE=2 SV=1 57 594 2.0E-159
sp|P28299|ACEA_NEUCR Isocitrate lyase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-3 PE=2 SV=2 59 594 6.0E-156
sp|P0CT06|ACEA_MAGO7 Isocitrate lyase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ICL1 PE=3 SV=1 59 594 1.0E-155
sp|L7HUY5|ACEA_MAGOY Isocitrate lyase OS=Magnaporthe oryzae (strain Y34) GN=ICL1 PE=2 SV=2 59 594 3.0E-155
sp|Q8NJ72|ACEA_KLULA Isocitrate lyase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ICL1 PE=2 SV=1 52 594 1.0E-153
sp|Q9HFN2|ACEA_CYBJA Isocitrate lyase OS=Cyberlindnera jadinii GN=ICL1 PE=3 SV=1 57 594 2.0E-153
sp|Q6BRY4|ACEA_DEBHA Isocitrate lyase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ICL1 PE=3 SV=1 49 594 2.0E-152
sp|Q4HYR2|ACEA_GIBZE Isocitrate lyase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ICL1 PE=3 SV=1 57 594 1.0E-151
sp|Q9P8Q7|ACEA_CANAX Isocitrate lyase OS=Candida albicans GN=ICL1 PE=3 SV=1 57 594 3.0E-151
sp|O94198|ACEA_ASHGO Isocitrate lyase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ICL1 PE=3 SV=1 51 594 2.0E-149
sp|P20014|ACEA_CANTR Isocitrate lyase OS=Candida tropicalis GN=ICL1 PE=3 SV=1 59 594 3.0E-148
sp|Q6FPK7|ACEA_CANGA Isocitrate lyase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ICL1 PE=3 SV=2 57 594 2.0E-147
sp|P28240|ACEA_YEAST Isocitrate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ICL1 PE=1 SV=1 61 594 4.0E-147
sp|Q9C124|ACEA_PICPA Isocitrate lyase OS=Komagataella pastoris GN=ICL1 PE=3 SV=1 57 594 4.0E-146
sp|P41555|ACEA_YARLI Isocitrate lyase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ICL1 PE=3 SV=3 58 594 3.0E-144
sp|Q8VJU4|ACEA2_MYCTO Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl2 PE=1 SV=2 63 593 2.0E-89
sp|H8F3R6|ACEA2_MYCTE Isocitrate lyase 2 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=aceAb PE=1 SV=1 63 593 2.0E-89
sp|Q7TZA8|ACEA2_MYCBO Isocitrate lyase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aceA PE=3 SV=1 63 593 2.0E-89
sp|P46831|ACEA_MYCLE Isocitrate lyase OS=Mycobacterium leprae (strain TN) GN=aceA PE=3 SV=2 62 565 3.0E-84
sp|Q9P6J1|ACEB_SCHPO Mitochondrial 2-methylisocitrate lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=icl2 PE=3 SV=1 73 580 5.0E-82
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 66 318 6.0E-51
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 66 318 6.0E-51
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 66 318 9.0E-51
sp|O07718|ACEAA_MYCTU Putative isocitrate lyase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAa PE=1 SV=1 63 318 2.0E-50
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 72 322 4.0E-46
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 73 318 7.0E-40
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 71 318 9.0E-40
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 71 318 9.0E-40
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 71 318 9.0E-40
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 71 318 9.0E-40
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 73 319 3.0E-39
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 73 318 1.0E-38
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 78 316 7.0E-37
sp|Q8RQN6|ACEA_COREF Isocitrate lyase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=aceA PE=3 SV=4 420 594 1.0E-34
sp|P42449|ACEA_CORGL Isocitrate lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aceA PE=1 SV=2 420 594 1.0E-34
sp|O07717|ACEAB_MYCTU Putative isocitrate lyase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aceAb PE=3 SV=1 413 593 1.0E-33
sp|P41554|ACEA_RHOFA Isocitrate lyase OS=Rhodococcus fascians GN=icl PE=3 SV=1 417 594 3.0E-33
sp|P9WKK7|ACEA_MYCTU Isocitrate lyase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=icl PE=1 SV=1 420 594 2.0E-32
sp|P9WKK6|ACEA1_MYCTO Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=icl1 PE=1 SV=1 420 594 2.0E-32
sp|H8EVV4|ACEA1_MYCTE Isocitrate lyase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=icl1 PE=1 SV=1 420 594 2.0E-32
sp|P0A5H4|ACEA1_MYCBO Isocitrate lyase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=icl PE=3 SV=1 420 594 2.0E-32
sp|P0A9G6|ACEA_ECOLI Isocitrate lyase OS=Escherichia coli (strain K12) GN=aceA PE=1 SV=1 392 594 9.0E-32
sp|P0A9G7|ACEA_ECOL6 Isocitrate lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aceA PE=3 SV=1 392 594 9.0E-32
sp|P51066|ACEA_SALTY Isocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aceA PE=3 SV=2 392 594 2.0E-31
sp|Q9K9H0|ACEA_BACHD Isocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aceA PE=3 SV=1 420 594 1.0E-27
sp|Q10663|GCP_CAEEL Bifunctional glyoxylate cycle protein OS=Caenorhabditis elegans GN=icl-1 PE=1 SV=2 414 594 2.0E-26
sp|O50078|ACEA_HYPME Isocitrate lyase OS=Hyphomicrobium methylovorum GN=aceA PE=1 SV=1 210 594 3.0E-17
sp|Q9I0K4|ACEA_PSEAE Isocitrate lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2634 PE=1 SV=1 134 298 1.0E-10
sp|P20699|ACEA_HELAN Isocitrate lyase (Fragment) OS=Helianthus annuus PE=2 SV=1 537 591 1.0E-10
sp|Q9KSC2|PRPB_VIBCH 2-methylisocitrate lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prpB PE=3 SV=1 124 298 5.0E-10
sp|D4GTL3|ACEA_HALVD Isocitrate lyase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aceA PE=1 SV=1 216 298 9.0E-10
sp|O49290|CPPM_ARATH Carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic OS=Arabidopsis thaliana GN=At1g77060 PE=2 SV=2 206 340 6.0E-09
sp|Q9YFM7|PRPB_AERPE 2-methylisocitrate lyase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=prpB PE=3 SV=2 216 298 1.0E-08
sp|Q56062|PRPB_SALTY 2-methylisocitrate lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpB PE=1 SV=3 119 298 1.0E-08
sp|Q8EJW1|PRPB_SHEON 2-methylisocitrate lyase OS=Shewanella oneidensis (strain MR-1) GN=prpB PE=3 SV=1 117 298 2.0E-08
sp|Q0QLE4|DML_EUBBA 2,3-dimethylmalate lyase OS=Eubacterium barkeri GN=Dml PE=1 SV=1 216 309 4.0E-08
sp|Q9Z9T7|PRPB_BACHD 2-methylisocitrate lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prpB PE=3 SV=1 145 321 2.0E-07
sp|P54528|PRPB_BACSU 2-methylisocitrate lyase OS=Bacillus subtilis (strain 168) GN=prpB PE=3 SV=1 216 321 4.0E-07
sp|P11435|CPPM_STRHY Carboxyvinyl-carboxyphosphonate phosphorylmutase OS=Streptomyces hygroscopicus GN=bcpA PE=1 SV=3 216 330 6.0E-07
sp|Q8NSL2|PRPB2_CORGL Probable 2-methylisocitrate lyase 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prpB2 PE=3 SV=1 216 309 3.0E-06
sp|Q937P0|PRPB_CUPNE 2-methylisocitrate lyase OS=Cupriavidus necator GN=prpB PE=1 SV=1 216 298 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004451 isocitrate lyase activity Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0043436 oxoacid metabolic process No
GO:0016833 oxo-acid-lyase activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006082 organic acid metabolic process No
GO:0016830 carbon-carbon lyase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2794
MTILQLARLSRRRLVVVVSPRRLFCQSRCMALDNPYTHGIAPADAFQLLPESQKAGEAEDALYEAQLRQVEAWWT
SRRFVGVRRPYSAEQVVSKRGTQLEVYASSVMAAKLFALVGEKLAKGEPIHTLGAIDPIQMTQQAPHQQALYVSG
WACSSLLTTTNEVSPDFGDYPYNTVPNQVHRLAKAQSLHDRKQWDARRQLSPAQRASTPYVDYLRPIIADGDTGH
GGLSAVTKLAKLFAEAGAAAVHFEDQLHGGKKCGHLAGKVLVPTSHHVNRLVAARFQWDVMGCENMLIARTDAES
GRLISSDIDARDHEFILGVADPALVDGEPLADAIQAMEARGASSADIDAFEEAWFANAKLLTFDEAAVAHLRRQG
LPRDAIDEYLASTRSHPNMSLSRRRALAANYARGLPVPFSWDVPRTREGYYHFQAGMPAATKRALAFAPYADLLW
VETGDPDVQVATQLARTVRAEFPAKGLVYNLSPSFNWMSHGFTPESLRSFVWDIAREGFVLQLVSLAGVHATAAA
AAELAPAFKRDGMRAYVDLVQRREKELACDVLTHQRWSGAAYMDGILGAIQSGSSSSKSMGKGNTEGQFD*
Coding >OphauB2|2794
ATGACAATTCTTCAACTCGCCCGCCTGTCCCGCCGCCGCCTCGTCGTCGTCGTCTCGCCGCGCCGCCTCTTTTGC
CAGTCGCGCTGCATGGCGCTGGACAATCCGTACACGCATGGTATTGCGCCGGCGGATGCCTTTCAGCTGCTGCCC
GAGTCGCAAAAGGCGGGCGAGGCGGAGGATGCCTTGTACGAGGCGCAGCTGCGGCAGGTGGAGGCGTGGTGGACG
TCGCGGCGCTTTGTGGGCGTGCGGCGGCCCTATTCGGCGGAGCAGGTGGTGTCGAAGCGAGGGACGCAGCTCGAG
GTGTATGCTAGTTCTGTCATGGCGGCCAAGCTGTTTGCGCTGGTGGGCGAAAAGTTGGCCAAGGGGGAGCCGATT
CATACTCTTGGCGCCATTGACCCCATTCAAATGACGCAGCAGGCCCCCCATCAACAAGCCCTCTACGTCTCGGGC
TGGGCCTGCTCCTCCCTCCTCACCACCACCAATGAAGTCTCCCCCGACTTTGGCGACTATCCCTACAACACCGTC
CCCAACCAGGTCCACCGCCTCGCCAAGGCCCAGTCCCTCCACGACCGCAAGCAATGGGACGCCCGCCGTCAGCTC
TCTCCCGCCCAGCGCGCCTCCACGCCCTATGTCGACTACCTGCGCCCCATTATTGCCGACGGCGACACGGGCCAC
GGCGGCCTCTCTGCCGTGACCAAGCTCGCCAAGCTCTTTGCCGAAGCCGGCGCCGCTGCCGTCCATTTTGAAGAC
CAGCTGCACGGCGGCAAAAAGTGCGGCCACTTGGCCGGCAAAGTCCTTGTCCCGACGAGCCACCACGTTAACCGC
CTCGTTGCCGCCCGCTTCCAGTGGGATGTGATGGGCTGTGAGAATATGCTTATTGCGCGCACAGATGCAGAGTCG
GGGCGTCTCATTTCCTCAGATATTGATGCGCGCGACCACGAGTTTATTCTCGGCGTGGCTGACCCAGCGCTCGTT
GACGGCGAGCCCCTCGCTGACGCTATCCAGGCCATGGAAGCCCGCGGCGCCTCGTCGGCAGATATCGACGCCTTT
GAAGAGGCCTGGTTTGCAAACGCCAAGCTCCTCACCTTTGACGAGGCTGCCGTGGCCCATCTCCGTCGCCAGGGC
CTGCCTCGCGACGCCATTGACGAATATCTCGCCTCCACGCGCTCCCATCCAAACATGTCTCTCTCGCGCCGTCGC
GCCCTGGCGGCAAACTATGCCCGCGGCCTGCCCGTGCCCTTTAGCTGGGACGTGCCGCGCACCCGCGAGGGCTAC
TACCACTTCCAGGCCGGCATGCCCGCCGCCACCAAGCGCGCCCTGGCTTTTGCCCCTTATGCCGACTTGCTCTGG
GTCGAGACGGGCGATCCAGACGTGCAAGTGGCAACCCAGCTTGCTCGCACTGTGCGCGCTGAGTTTCCCGCAAAG
GGGCTCGTCTATAACCTCTCGCCCTCCTTCAATTGGATGAGCCATGGCTTTACCCCAGAGTCGCTCCGCTCTTTT
GTCTGGGACATTGCCCGCGAGGGCTTCGTCTTGCAGCTCGTCTCCTTGGCCGGCGTGCATGCCACGGCGGCTGCG
GCGGCCGAACTGGCCCCTGCCTTTAAGAGGGACGGCATGCGCGCCTATGTCGACTTGGTGCAGCGCCGCGAAAAG
GAGCTTGCCTGCGACGTCTTGACTCATCAGCGCTGGAGCGGCGCGGCATACATGGACGGTATCCTTGGGGCGATC
CAGAGCGGGAGCTCCAGCAGCAAGAGCATGGGCAAGGGCAACACTGAGGGACAGTTTGACTAG
Transcript >OphauB2|2794
ATGACAATTCTTCAACTCGCCCGCCTGTCCCGCCGCCGCCTCGTCGTCGTCGTCTCGCCGCGCCGCCTCTTTTGC
CAGTCGCGCTGCATGGCGCTGGACAATCCGTACACGCATGGTATTGCGCCGGCGGATGCCTTTCAGCTGCTGCCC
GAGTCGCAAAAGGCGGGCGAGGCGGAGGATGCCTTGTACGAGGCGCAGCTGCGGCAGGTGGAGGCGTGGTGGACG
TCGCGGCGCTTTGTGGGCGTGCGGCGGCCCTATTCGGCGGAGCAGGTGGTGTCGAAGCGAGGGACGCAGCTCGAG
GTGTATGCTAGTTCTGTCATGGCGGCCAAGCTGTTTGCGCTGGTGGGCGAAAAGTTGGCCAAGGGGGAGCCGATT
CATACTCTTGGCGCCATTGACCCCATTCAAATGACGCAGCAGGCCCCCCATCAACAAGCCCTCTACGTCTCGGGC
TGGGCCTGCTCCTCCCTCCTCACCACCACCAATGAAGTCTCCCCCGACTTTGGCGACTATCCCTACAACACCGTC
CCCAACCAGGTCCACCGCCTCGCCAAGGCCCAGTCCCTCCACGACCGCAAGCAATGGGACGCCCGCCGTCAGCTC
TCTCCCGCCCAGCGCGCCTCCACGCCCTATGTCGACTACCTGCGCCCCATTATTGCCGACGGCGACACGGGCCAC
GGCGGCCTCTCTGCCGTGACCAAGCTCGCCAAGCTCTTTGCCGAAGCCGGCGCCGCTGCCGTCCATTTTGAAGAC
CAGCTGCACGGCGGCAAAAAGTGCGGCCACTTGGCCGGCAAAGTCCTTGTCCCGACGAGCCACCACGTTAACCGC
CTCGTTGCCGCCCGCTTCCAGTGGGATGTGATGGGCTGTGAGAATATGCTTATTGCGCGCACAGATGCAGAGTCG
GGGCGTCTCATTTCCTCAGATATTGATGCGCGCGACCACGAGTTTATTCTCGGCGTGGCTGACCCAGCGCTCGTT
GACGGCGAGCCCCTCGCTGACGCTATCCAGGCCATGGAAGCCCGCGGCGCCTCGTCGGCAGATATCGACGCCTTT
GAAGAGGCCTGGTTTGCAAACGCCAAGCTCCTCACCTTTGACGAGGCTGCCGTGGCCCATCTCCGTCGCCAGGGC
CTGCCTCGCGACGCCATTGACGAATATCTCGCCTCCACGCGCTCCCATCCAAACATGTCTCTCTCGCGCCGTCGC
GCCCTGGCGGCAAACTATGCCCGCGGCCTGCCCGTGCCCTTTAGCTGGGACGTGCCGCGCACCCGCGAGGGCTAC
TACCACTTCCAGGCCGGCATGCCCGCCGCCACCAAGCGCGCCCTGGCTTTTGCCCCTTATGCCGACTTGCTCTGG
GTCGAGACGGGCGATCCAGACGTGCAAGTGGCAACCCAGCTTGCTCGCACTGTGCGCGCTGAGTTTCCCGCAAAG
GGGCTCGTCTATAACCTCTCGCCCTCCTTCAATTGGATGAGCCATGGCTTTACCCCAGAGTCGCTCCGCTCTTTT
GTCTGGGACATTGCCCGCGAGGGCTTCGTCTTGCAGCTCGTCTCCTTGGCCGGCGTGCATGCCACGGCGGCTGCG
GCGGCCGAACTGGCCCCTGCCTTTAAGAGGGACGGCATGCGCGCCTATGTCGACTTGGTGCAGCGCCGCGAAAAG
GAGCTTGCCTGCGACGTCTTGACTCATCAGCGCTGGAGCGGCGCGGCATACATGGACGGTATCCTTGGGGCGATC
CAGAGCGGGAGCTCCAGCAGCAAGAGCATGGGCAAGGGCAACACTGAGGGACAGTTTGACTAG
Gene >OphauB2|2794
ATGACAATTCTTCAACTCGCCCGCCTGTCCCGCCGCCGCCTCGTCGTCGTCGTCTCGCCGCGCCGCCTCTTTTGC
CAGTCGCGCTGCATGGCGCTGGACAATCCGTACACGCATGGTATTGCGCCGGCGGATGCCTTTCAGCTGCTGCCC
GAGTCGCAAAAGGCGGGCGAGGCGGAGGATGCCTTGTACGAGGCGCAGCTGCGGCAGGTGGAGGCGTGGTGGACG
TCGCGGCGCTTTGTGGGCGTGCGGCGGCCCTATTCGGCGGAGCAGGTGGTGTCGAAGCGAGGGACGCAGCTCGAG
GTGTATGCTAGTTCTGTCATGGCGGCCAAGCTGTTTGCGCTGGTGGGCGAAAAGTTGGCCAAGGGGGAGCCGATT
CATACTCGTGAGTCTCGACTCTAGCACCCACCTACAGTCTTGCACCTACACTCCACCACCTACACTCCAACTTGT
TTCAAGACTCTAGCACGGGAAAAAAAACTGACTCCTCTCTCTAGTTGGCGCCATTGACCCCATTCAAATGACGCA
GCAGGCCCCCCATCAACAAGCCCTCTACGTCTCGGGCTGGGCCTGCTCCTCCCTCCTCACCACCACCAATGAAGT
CTCCCCCGACTTTGGCGACTATCCCTACAACACCGTCCCCAACCAGGTCCACCGCCTCGCCAAGGCCCAGTCCCT
CCACGACCGCAAGCAATGGGACGCCCGCCGTCAGCTCTCTCCCGCCCAGCGCGCCTCCACGCCCTATGTCGACTA
CCTGCGCCCCATTATTGCCGACGGCGACACGGGCCACGGCGGCCTCTCTGCCGTGACCAAGCTCGCCAAGCTCTT
TGCCGAAGCCGGCGCCGCTGCCGTCCATTTTGAAGACCAGCTGCACGGCGGCAAAAAGTGCGGCCACTTGGCCGG
CAAAGTCCTTGTCCCGACGAGCCACCACGTTAACCGCCTCGTTGCCGCCCGCTTCCAGTGGGATGTGATGGGCTG
TGAGAATATGCTTATTGCGCGCACAGATGCAGAGTCGGGGCGTCTCATTTCCTCAGATATTGATGCGCGCGACCA
CGAGTTTATTCTCGGCGTGGCTGACCCAGCGCTCGTTGACGGCGAGCCCCTCGCTGACGCTATCCAGGCCATGGA
AGCCCGCGGCGCCTCGTCGGCAGATATCGACGCCTTTGAAGAGGCCTGGTTTGCAAACGCCAAGCTCCTCACCTT
TGACGAGGCTGCCGTGGCCCATCTCCGTCGCCAGGGCCTGCCTCGCGACGCCATTGACGAATATCTCGCCTCCAC
GCGCTCCCATCCAAACATGTCTCTCTCGCGCCGTCGCGCCCTGGCGGCAAACTATGCCCGCGGCCTGCCCGTGCC
CTTTAGCTGGGACGTGCCGCGCACCCGCGAGGGCTACTACCACTTCCAGGCCGGCATGCCCGCCGCCACCAAGCG
CGCCCTGGCTTTTGCCCCTTATGCCGACTTGCTCTGGGTCGAGACGGGCGATCCAGACGTGCAAGTGGCAACCCA
GCTTGCTCGCACTGTGCGCGCTGAGTTTCCCGCAAAGGGGCTCGTCTATAACCTCTCGCCCTCCTTCAATTGGAT
GAGCCATGGCTTTACCCCAGAGTCGCTCCGCTCTTTTGTCTGGGACATTGCCCGCGAGGGCTTCGTCTTGCAGCT
CGTCTCCTTGGCCGGCGTGCATGCCACGGCGGCTGCGGCGGCCGAACTGGCCCCTGCCTTTAAGAGGGACGGCAT
GCGCGCCTATGTCGACTTGGTGCAGCGCCGCGAAAAGGAGCTTGCCTGCGACGTCTTGACTCATCAGCGCTGGAG
CGGCGCGGCATACATGGACGGTATCCTTGGGGCGATCCAGAGCGGGAGCTCCAGCAGCAAGAGCATGGGCAAGGG
CAACACTGAGGGACAGTTTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail