Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2793
Gene name
LocationContig_191:9478..10520
Strand+
Gene length (bp)1042
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.4E-61 18 260
PF00106 adh_short short chain dehydrogenase 4.2E-43 12 207
PF08659 KR KR domain 6.1E-09 15 177
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 5.9E-05 18 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 7 259 2.0E-42
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 1 260 1.0E-40
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 8 259 2.0E-40
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 9 260 3.0E-39
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 12 260 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 7 259 2.0E-42
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 1 260 1.0E-40
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 8 259 2.0E-40
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 9 260 3.0E-39
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 12 260 3.0E-39
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 3 263 3.0E-37
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 7 258 4.0E-37
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 7 258 2.0E-36
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 7 258 1.0E-35
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 7 258 2.0E-35
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 8 262 2.0E-35
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 7 258 4.0E-35
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 7 260 4.0E-34
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 7 260 4.0E-34
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 14 258 6.0E-34
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 8 260 1.0E-33
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 7 258 5.0E-33
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 8 258 7.0E-33
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 11 260 1.0E-32
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 9 261 1.0E-32
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 7 258 2.0E-32
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 8 258 3.0E-32
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 8 260 8.0E-32
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 1 265 1.0E-31
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 1 259 1.0E-31
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 7 260 2.0E-31
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 7 260 2.0E-31
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 8 260 4.0E-31
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 8 258 8.0E-31
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 8 259 2.0E-30
sp|Q9BUT1|BDH2_HUMAN 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 7 258 3.0E-30
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 15 259 4.0E-30
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 8 258 4.0E-30
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 9 258 6.0E-30
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 9 258 6.0E-30
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 9 258 6.0E-30
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 14 260 6.0E-30
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 9 261 7.0E-30
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 5 258 8.0E-30
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 5 258 8.0E-30
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 8 260 1.0E-29
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 15 260 1.0E-29
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 9 261 1.0E-29
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 5 258 2.0E-29
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 7 260 5.0E-29
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 9 261 5.0E-29
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 8 258 6.0E-29
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 8 260 6.0E-29
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 9 261 8.0E-29
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 9 259 8.0E-29
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 7 258 8.0E-29
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 9 261 9.0E-29
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 9 261 9.0E-29
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 9 261 1.0E-28
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 9 260 2.0E-28
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 8 260 2.0E-28
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 7 260 2.0E-28
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 8 262 3.0E-28
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 8 259 3.0E-28
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 9 260 5.0E-28
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 9 262 9.0E-28
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 9 262 9.0E-28
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 7 273 1.0E-27
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 15 259 1.0E-27
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 15 259 1.0E-27
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 9 260 1.0E-27
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 8 266 2.0E-27
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 8 260 2.0E-27
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 8 260 2.0E-27
sp|P19871|3BHD_COMTE 3-beta-hydroxysteroid dehydrogenase OS=Comamonas testosteroni PE=1 SV=5 8 256 3.0E-27
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 8 259 3.0E-27
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 15 259 4.0E-27
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 7 259 4.0E-27
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 8 258 4.0E-27
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 15 259 5.0E-27
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 15 259 5.0E-27
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 9 258 1.0E-26
sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 8 262 1.0E-26
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 9 259 3.0E-26
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 12 259 3.0E-26
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 12 259 3.0E-26
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 12 259 4.0E-26
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 12 259 4.0E-26
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 12 259 4.0E-26
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 12 259 4.0E-26
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 12 259 4.0E-26
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 12 259 4.0E-26
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 16 259 5.0E-26
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 8 260 5.0E-26
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 16 259 5.0E-26
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 16 259 6.0E-26
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 12 259 8.0E-26
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 7 261 9.0E-26
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 16 260 1.0E-25
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 9 258 1.0E-25
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 5 261 2.0E-25
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 9 258 3.0E-25
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 3 260 3.0E-25
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 9 260 5.0E-25
sp|Q94KL8|SILD_PODPE Secoisolariciresinol dehydrogenase (Fragment) OS=Podophyllum peltatum PE=1 SV=1 28 261 7.0E-25
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 12 260 1.0E-24
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 9 259 3.0E-24
sp|Q9MYP6|DHB14_BOVIN 17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1 8 275 3.0E-24
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 8 258 4.0E-24
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 1 259 4.0E-24
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 5 260 7.0E-24
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 11 259 1.0E-23
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 9 258 1.0E-23
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 9 260 1.0E-23
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 16 259 1.0E-23
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 9 267 1.0E-23
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 8 259 2.0E-23
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 7 258 2.0E-23
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 1 258 3.0E-23
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 1 258 3.0E-23
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 1 258 3.0E-23
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 5 259 3.0E-23
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 4 258 3.0E-23
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 14 258 5.0E-23
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 5 260 5.0E-23
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 8 260 8.0E-23
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 8 258 9.0E-23
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 9 259 1.0E-22
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 1 258 2.0E-22
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 5 260 2.0E-22
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 1 258 2.0E-22
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 9 258 3.0E-22
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 14 259 3.0E-22
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 12 259 4.0E-22
sp|A3LZU7|RM1DH_PICST L-rhamnose-1-dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHG2 PE=1 SV=2 7 259 4.0E-22
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 9 259 5.0E-22
sp|Q9BPX1|DHB14_HUMAN 17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1 31 263 5.0E-22
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 9 260 8.0E-22
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 9 255 8.0E-22
sp|P43066|ARDH_CANAW D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida albicans (strain WO-1) GN=ARD1 PE=3 SV=1 8 258 9.0E-22
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 9 259 1.0E-21
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 12 259 1.0E-21
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 9 260 1.0E-21
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 8 261 2.0E-21
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 7 258 2.0E-21
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 7 258 2.0E-21
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 5 260 2.0E-21
sp|P22441|DHMA_FLAS1 N-acylmannosamine 1-dehydrogenase OS=Flavobacterium sp. (strain 141-8) PE=1 SV=3 3 260 2.0E-21
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 9 255 2.0E-21
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 9 259 3.0E-21
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 9 258 3.0E-21
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 9 259 4.0E-21
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 9 259 4.0E-21
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 16 259 7.0E-21
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 8 259 7.0E-21
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 9 260 1.0E-20
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 11 259 1.0E-20
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 7 262 1.0E-20
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 11 258 2.0E-20
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 1 258 2.0E-20
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 12 257 2.0E-20
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 12 227 4.0E-20
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 4 260 4.0E-20
sp|O34717|FADH_BACSU Probable 2,4-dienoyl-CoA reductase OS=Bacillus subtilis (strain 168) GN=fadH PE=2 SV=1 12 258 6.0E-20
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 5 260 6.0E-20
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 12 258 6.0E-20
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 12 258 6.0E-20
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 2 260 7.0E-20
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 14 259 8.0E-20
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 9 258 9.0E-20
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 8 260 9.0E-20
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 9 260 1.0E-19
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 8 258 1.0E-19
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 1 258 3.0E-19
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 14 259 3.0E-19
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 1 258 4.0E-19
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 9 258 5.0E-19
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 9 260 5.0E-19
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 9 260 5.0E-19
sp|Q6MGB5|DHB8_RAT Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=1 SV=1 4 259 5.0E-19
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 12 221 6.0E-19
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 6 260 6.0E-19
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 14 258 6.0E-19
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 8 259 7.0E-19
sp|P27582|FABG6_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) OS=Brassica napus PE=1 SV=3 70 259 7.0E-19
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 9 259 7.0E-19
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 90 259 7.0E-19
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 12 257 8.0E-19
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 9 258 9.0E-19
sp|P0C0Y4|MTDH_ALTAL Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 9 259 9.0E-19
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 9 257 1.0E-18
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 14 258 2.0E-18
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 1 258 3.0E-18
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 1 258 3.0E-18
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 1 260 3.0E-18
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 12 259 3.0E-18
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 8 259 3.0E-18
sp|Q8NK50|MTDH_HYPJE NADP-dependent mannitol dehydrogenase OS=Hypocrea jecorina GN=lxr1 PE=1 SV=1 9 260 4.0E-18
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 8 258 4.0E-18
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 11 259 4.0E-18
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 11 259 4.0E-18
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 9 259 4.0E-18
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 8 262 4.0E-18
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 11 205 5.0E-18
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 9 258 6.0E-18
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 8 207 6.0E-18
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 69 259 7.0E-18
sp|O31642|YJDA_BACSU Uncharacterized oxidoreductase YjdA OS=Bacillus subtilis (strain 168) GN=yjdA PE=3 SV=1 12 261 7.0E-18
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 8 261 8.0E-18
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 1 259 1.0E-17
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 11 259 1.0E-17
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 11 259 1.0E-17
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 7 258 2.0E-17
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 5 258 2.0E-17
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 9 260 2.0E-17
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 11 261 2.0E-17
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 14 259 2.0E-17
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 9 259 2.0E-17
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 12 259 3.0E-17
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 12 259 3.0E-17
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 12 259 3.0E-17
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 12 259 3.0E-17
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 12 259 3.0E-17
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 12 259 3.0E-17
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 14 258 4.0E-17
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 9 261 4.0E-17
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 9 261 4.0E-17
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 8 259 4.0E-17
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 9 220 4.0E-17
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 8 258 4.0E-17
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 14 258 4.0E-17
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 8 259 5.0E-17
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 9 260 5.0E-17
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 9 258 6.0E-17
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 14 262 9.0E-17
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 11 205 1.0E-16
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 9 259 1.0E-16
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 1 259 1.0E-16
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 30 259 1.0E-16
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 9 255 1.0E-16
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 9 255 1.0E-16
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 9 220 1.0E-16
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 9 220 1.0E-16
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 9 220 1.0E-16
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 1 260 2.0E-16
sp|G0RH19|LXR3_HYPJQ L-xylulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr3 PE=1 SV=1 9 260 2.0E-16
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 1 260 2.0E-16
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 3 261 2.0E-16
sp|Q92RN6|GALD_RHIME Probable galactose dehydrogenase GalD OS=Rhizobium meliloti (strain 1021) GN=galD PE=3 SV=1 1 259 3.0E-16
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 5 260 3.0E-16
sp|O13908|YF3H_SCHPO Uncharacterized oxidoreductase C22A12.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.17c PE=3 SV=1 9 260 5.0E-16
sp|Q9JIF5|PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1 35 258 5.0E-16
sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 5 258 6.0E-16
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 8 258 6.0E-16
sp|P44481|Y048_HAEIN Uncharacterized oxidoreductase HI_0048 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0048 PE=1 SV=1 1 260 6.0E-16
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 9 259 9.0E-16
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 5 260 1.0E-15
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 12 258 2.0E-15
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 12 259 2.0E-15
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 8 205 2.0E-15
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 9 258 2.0E-15
sp|P55435|Y4EL_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eL OS=Rhizobium sp. (strain NGR234) GN=NGR_a03830 PE=3 SV=1 9 262 2.0E-15
sp|P0C0Y5|MTDH_DAVTA Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 9 260 2.0E-15
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 9 258 2.0E-15
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 11 205 2.0E-15
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 11 205 2.0E-15
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 9 220 2.0E-15
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 9 220 2.0E-15
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 9 259 3.0E-15
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 15 259 3.0E-15
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 3 246 3.0E-15
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 8 258 4.0E-15
sp|Q1RKB7|FABG_RICBR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1 69 259 4.0E-15
sp|Q9Y6Z9|SOU1_SCHPO Sorbose reductase sou1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sou1 PE=3 SV=1 9 259 4.0E-15
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 9 259 4.0E-15
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 4 259 6.0E-15
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 2 195 7.0E-15
sp|Q4WZ66|CHADH_ASPFU Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 16 255 1.0E-14
sp|D3J0Z1|CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 16 255 1.0E-14
sp|P9WGQ3|Y1714_MYCTU Uncharacterized oxidoreductase Rv1714 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1714 PE=3 SV=1 69 260 1.0E-14
sp|P9WGQ2|Y1714_MYCTO Uncharacterized oxidoreductase MT1753.1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1753.1 PE=3 SV=1 69 260 1.0E-14
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 8 206 2.0E-14
sp|Q920P0|DCXR_RAT L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1 9 259 2.0E-14
sp|Q4UK62|FABG_RICFE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabG PE=3 SV=1 30 259 2.0E-14
sp|P9WGQ5|Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 8 260 3.0E-14
sp|P9WGQ4|Y927C_MYCTO Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 8 260 3.0E-14
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 9 259 3.0E-14
sp|Q51576|Y3106_PSEAE Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 11 264 4.0E-14
sp|Q8RX32|TRNH2_ARATH Tropinone reductase homolog At1g07450 OS=Arabidopsis thaliana GN=At1g07450 PE=2 SV=1 9 260 4.0E-14
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 3 261 5.0E-14
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 3 261 5.0E-14
sp|P9WGQ7|Y1144_MYCTU Uncharacterized oxidoreductase Rv1144 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1144 PE=1 SV=1 14 262 6.0E-14
sp|P9WGQ6|Y1144_MYCTO Uncharacterized oxidoreductase MT1177 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1177 PE=3 SV=1 14 262 6.0E-14
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 9 257 9.0E-14
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 1 259 9.0E-14
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 12 262 1.0E-13
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 9 204 1.0E-13
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 12 260 1.0E-13
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 16 201 1.0E-13
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 16 201 1.0E-13
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 16 201 1.0E-13
sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 12 196 1.0E-13
sp|Q9XT00|DHB8_PIG Estradiol 17-beta-dehydrogenase 8 OS=Sus scrofa GN=HSD17B8 PE=3 SV=2 8 259 1.0E-13
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 8 259 1.0E-13
sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 9 258 2.0E-13
sp|Q920N9|DCXR_CAVPO L-xylulose reductase OS=Cavia porcellus GN=DCXR PE=2 SV=1 9 259 2.0E-13
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 5 258 2.0E-13
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 8 219 3.0E-13
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 8 219 3.0E-13
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 4 259 3.0E-13
sp|B8H1Z0|XDH_CAUCN D-xylose 1-dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=xylB PE=1 SV=1 1 258 3.0E-13
sp|P50171|DHB8_MOUSE Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus GN=Hsd17b8 PE=1 SV=2 8 259 5.0E-13
sp|Q9Z2M4|DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 9 258 5.0E-13
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 9 260 6.0E-13
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 11 261 6.0E-13
sp|P0C622|CMTB_PSEPU 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida GN=cmtB PE=3 SV=1 9 260 6.0E-13
sp|A5W4G5|CMTB_PSEP1 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cmtB PE=3 SV=1 9 260 6.0E-13
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 12 258 1.0E-12
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 12 250 1.0E-12
sp|O93868|MTDH_AGABI NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3 63 258 1.0E-12
sp|P40747|YUXG_BACSU Uncharacterized oxidoreductase YuxG OS=Bacillus subtilis (strain 168) GN=yuxG PE=3 SV=2 6 263 1.0E-12
sp|Q70UN9|ADH1_CERCO Alcohol dehydrogenase 1 OS=Ceratitis cosyra GN=ADH1 PE=3 SV=1 9 203 1.0E-12
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 5 201 1.0E-12
sp|Q99MZ7|PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus GN=Pecr PE=1 SV=1 35 258 2.0E-12
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 8 270 2.0E-12
sp|Q23116|YWC4_CAEEL Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 5 258 3.0E-12
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 5 206 3.0E-12
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 9 196 3.0E-12
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 2 259 4.0E-12
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 1 206 4.0E-12
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 8 196 5.0E-12
sp|P0DMP5|CALA_PSEUH Coniferyl-alcohol dehydrogenase OS=Pseudomonas sp. (strain HR199 / DSM 7063) GN=calA PE=1 SV=1 8 264 5.0E-12
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 5 206 6.0E-12
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 8 242 6.0E-12
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 5 206 7.0E-12
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 8 196 8.0E-12
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 15 261 9.0E-12
sp|Q9LTV6|DECR2_ARATH Peroxisomal 2,4-dienoyl-CoA reductase OS=Arabidopsis thaliana GN=At3g12800 PE=2 SV=1 11 259 1.0E-11
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 13 214 2.0E-11
sp|P50203|PHAB_ACISR Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 12 259 2.0E-11
sp|P80702|DIDH_COMTE 3-alpha-hydroxysteroid dehydrogenase/carbonyl reductase OS=Comamonas testosteroni GN=hsdA PE=1 SV=2 152 259 3.0E-11
sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 7 139 3.0E-11
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 6 262 3.0E-11
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 1 194 3.0E-11
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 9 205 3.0E-11
sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 7 139 3.0E-11
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 2 259 3.0E-11
sp|P0CG22|DR4L1_HUMAN Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 9 258 4.0E-11
sp|Q9CQ62|DECR_MOUSE 2,4-dienoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Decr1 PE=1 SV=1 9 258 5.0E-11
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 5 206 5.0E-11
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 3 258 5.0E-11
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 5 196 6.0E-11
sp|P06235|NODG_RHIML Nodulation protein G OS=Rhizobium meliloti GN=nodG PE=3 SV=1 9 259 7.0E-11
sp|O34896|UXUB_BACSU Uncharacterized oxidoreductase UxuB OS=Bacillus subtilis (strain 168) GN=uxuB PE=2 SV=1 9 259 7.0E-11
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 8 201 9.0E-11
sp|Q7Z4W1|DCXR_HUMAN L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2 9 259 1.0E-10
sp|G5DGA8|IDLDH_IPSPI Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 15 259 2.0E-10
sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 7 139 2.0E-10
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 1 243 2.0E-10
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 7 257 3.0E-10
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 8 196 3.0E-10
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 5 201 3.0E-10
sp|P48814|ADH1_CERCA Alcohol dehydrogenase 1 OS=Ceratitis capitata GN=ADH1 PE=3 SV=1 9 203 3.0E-10
sp|O34308|YTKK_BACSU Putative oxidoreductase YtkK OS=Bacillus subtilis (strain 168) GN=ytkK PE=3 SV=1 12 259 4.0E-10
sp|Q99L04|DHRS1_MOUSE Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=1 SV=1 9 211 5.0E-10
sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=1 SV=1 7 170 5.0E-10
sp|P47230|BPHB_RHOGO Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Rhodococcus globerulus GN=bphB PE=3 SV=1 8 259 7.0E-10
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 11 204 8.0E-10
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 5 201 9.0E-10
sp|Q70UP6|ADH2_CERRO Alcohol dehydrogenase 2 OS=Ceratitis rosa GN=ADH2 PE=3 SV=1 9 203 9.0E-10
sp|Q70UP5|ADH2_CERCO Alcohol dehydrogenase 2 OS=Ceratitis cosyra GN=ADH2 PE=3 SV=1 9 203 1.0E-09
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 11 206 1.0E-09
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 11 206 1.0E-09
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 14 259 1.0E-09
sp|Q64591|DECR_RAT 2,4-dienoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Decr1 PE=1 SV=2 9 258 1.0E-09
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 8 268 1.0E-09
sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 7 139 2.0E-09
sp|Q4V8F9|HSDL2_RAT Hydroxysteroid dehydrogenase-like protein 2 OS=Rattus norvegicus GN=Hsdl2 PE=2 SV=1 7 139 2.0E-09
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 12 205 3.0E-09
sp|Q8JIS3|DER_CHICK D-erythrulose reductase OS=Gallus gallus GN=DER PE=1 SV=1 11 259 3.0E-09
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 5 205 3.0E-09
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 7 196 3.0E-09
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 1 201 4.0E-09
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 12 259 4.0E-09
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 12 259 4.0E-09
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 12 259 4.0E-09
sp|Q96LJ7|DHRS1_HUMAN Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 9 212 4.0E-09
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 12 196 5.0E-09
sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 1 212 5.0E-09
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 9 205 5.0E-09
sp|Q56632|VIBA_VIBCH Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibA PE=3 SV=1 9 260 5.0E-09
sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 7 139 5.0E-09
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 8 259 8.0E-09
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 12 259 9.0E-09
sp|P08694|BPHB_PSEPS Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas pseudoalcaligenes GN=bphB PE=3 SV=2 8 259 1.0E-08
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 9 258 2.0E-08
sp|Q8LEU3|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=1 SV=1 2 214 2.0E-08
sp|Q9GME3|DHB8_CALJA Estradiol 17-beta-dehydrogenase 8 (Fragment) OS=Callithrix jacchus GN=HSD17B8 PE=2 SV=1 115 250 2.0E-08
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 29 192 3.0E-08
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 12 259 3.0E-08
sp|Q93761|YXEK_CAEEL Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans GN=F53C11.3 PE=3 SV=1 7 258 4.0E-08
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 11 205 4.0E-08
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 8 259 5.0E-08
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 8 180 8.0E-08
sp|P0A169|NAHB_PSEPU 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Pseudomonas putida GN=nahB PE=3 SV=1 16 259 8.0E-08
sp|P0A170|NAHB_PSEU8 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Pseudomonas sp. (strain C18) GN=doxE PE=3 SV=1 16 259 9.0E-08
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 3 205 1.0E-07
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 9 220 1.0E-07
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 70 259 2.0E-07
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 11 125 2.0E-07
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 9 211 2.0E-07
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 9 176 3.0E-07
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 9 176 3.0E-07
sp|O74959|YJCD_SCHPO Uncharacterized oxidoreductase C736.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC736.13 PE=3 SV=1 9 100 4.0E-07
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 9 234 4.0E-07
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 11 259 4.0E-07
sp|Q00670|ADH_SCACA Alcohol dehydrogenase OS=Scaptomyza crassifemur GN=Adh PE=3 SV=1 9 223 4.0E-07
sp|Q6P5L8|HSDL2_DANRE Hydroxysteroid dehydrogenase-like protein 2 OS=Danio rerio GN=hsdl2 PE=2 SV=1 7 139 5.0E-07
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 9 180 5.0E-07
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 28 197 7.0E-07
sp|P24267|ADH2_DROWH Alcohol dehydrogenase 2 OS=Drosophila wheeleri GN=Adh2 PE=3 SV=3 9 208 8.0E-07
sp|P27583|FABG_PERAE 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) OS=Persea americana PE=1 SV=3 43 102 9.0E-07
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 9 220 9.0E-07
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 12 205 1.0E-06
sp|P10807|ADH_DROLE Alcohol dehydrogenase OS=Drosophila lebanonensis GN=Adh PE=1 SV=1 9 208 1.0E-06
sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 1 220 1.0E-06
sp|P54795|MOAE_ENTAE Protein MoaE OS=Enterobacter aerogenes GN=moaE PE=3 SV=1 145 258 1.0E-06
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 1 220 1.0E-06
sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 1 220 2.0E-06
sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 1 220 2.0E-06
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 10 227 2.0E-06
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 11 152 2.0E-06
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 9 220 2.0E-06
sp|Q93UV4|FLNB_TERSD Fluoren-9-ol dehydrogenase OS=Terrabacter sp. (strain DBF63) GN=flnB PE=1 SV=1 6 196 2.0E-06
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 6 240 2.0E-06
sp|Q5XGF7|RDH10_XENTR Retinol dehydrogenase 10 OS=Xenopus tropicalis GN=rdh10 PE=2 SV=1 9 220 2.0E-06
sp|P25988|ADH_SCAAL Alcohol dehydrogenase OS=Scaptomyza albovittata GN=Adh PE=3 SV=1 9 223 2.0E-06
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 2 203 2.0E-06
sp|P51552|ADH_ZAPTU Alcohol dehydrogenase OS=Zaprionus tuberculatus GN=Adh PE=3 SV=1 9 208 3.0E-06
sp|Q6RVV4|TIC32_PEA Short-chain dehydrogenase TIC 32, chloroplastic OS=Pisum sativum GN=TIC32 PE=1 SV=1 10 152 4.0E-06
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 2 203 5.0E-06
sp|Q9WXG7|DPDD_ALCFA Cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase OS=Alcaligenes faecalis GN=phnB PE=1 SV=1 9 271 5.0E-06
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 9 240 5.0E-06
sp|B0D8R3|MKAR_LACBS Very-long-chain 3-oxoacyl-CoA reductase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_192627 PE=3 SV=1 14 201 5.0E-06
sp|Q16698|DECR_HUMAN 2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=DECR1 PE=1 SV=1 9 258 6.0E-06
sp|P87017|AFLH_ASPPA 5'-hydroxyaverantin dehydrogenase OS=Aspergillus parasiticus GN=adhA PE=1 SV=2 7 204 7.0E-06
sp|Q5N800|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Oryza sativa subsp. japonica GN=NYC1 PE=1 SV=1 12 149 8.0E-06
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 9 100 8.0E-06
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 15 231 9.0E-06
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 9 211 9.0E-06
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 9 196 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0006631 fatty acid metabolic process Yes
GO:1901363 heterocyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043436 oxoacid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0006629 lipid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0051287 NAD binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4761
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2793 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02426
Ophiocordyceps camponoti-rufipedis Ophun1|6772
Ophiocordyceps kimflemingae Ophio5|2809
Ophiocordyceps subramaniannii Hirsu2|1002

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2793
MASAQKGRLAGKNAIITGAAGGIGLETAILFAKEGANVMMSDISAEALQKALAKVQQLVPAGRVETTKCDVSKEA
DVKALVEALDGWGGVDVMFNNAGIMHADDADAVDTPEAIWDLTQAINVKGVWFGCKHAVLSLRRHNKTAGSIINT
ASIVALVGAAAPQLAYTASKGAVLALTRELAMVHAREGFRFNSLCPAPLNTPLLQDWLGDDKAKRARREVHFPMG
RFGEAVEQAHAVVFLASNESSFVNGHDFAVDGGLTKAYVTAEGPAARAPANNALKSSLE*
Coding >OphauB2|2793
ATGGCTTCTGCGCAAAAGGGCCGTTTGGCCGGCAAAAACGCAATCATTACCGGCGCTGCCGGTGGCATTGGTCTC
GAGACGGCTATTCTCTTCGCCAAAGAGGGCGCCAATGTCATGATGTCGGACATTTCGGCCGAAGCGCTGCAAAAG
GCTCTGGCAAAAGTCCAGCAGCTCGTCCCCGCCGGGCGTGTCGAGACGACGAAATGCGACGTTTCCAAAGAAGCC
GACGTCAAGGCTCTCGTCGAGGCGCTGGATGGCTGGGGCGGCGTCGACGTCATGTTCAACAATGCCGGCATCATG
CACGCCGACGATGCCGATGCCGTTGACACGCCCGAGGCCATTTGGGACTTGACGCAGGCCATCAATGTCAAGGGC
GTCTGGTTTGGCTGCAAGCACGCCGTGCTCTCGCTGCGACGCCACAACAAGACGGCAGGCTCCATCATCAATACC
GCCTCCATTGTTGCCCTGGTGGGCGCCGCCGCGCCTCAGCTCGCCTACACGGCCTCCAAGGGCGCCGTCTTGGCC
CTGACGCGCGAACTTGCCATGGTGCATGCCCGCGAGGGCTTTCGCTTCAATTCGCTCTGTCCGGCGCCGCTAAAC
ACGCCCTTGCTGCAGGACTGGCTGGGCGACGACAAGGCCAAGCGCGCGCGCAGAGAGGTGCATTTCCCAATGGGG
CGCTTTGGCGAGGCGGTTGAGCAGGCTCACGCTGTCGTCTTCTTGGCCAGCAACGAGTCGAGCTTTGTCAATGGC
CATGATTTCGCCGTGGATGGTGGCCTGACCAAGGCCTATGTTACGGCCGAGGGGCCTGCTGCCCGGGCGCCCGCC
AATAATGCTCTCAAGAGCTCGCTCGAATGA
Transcript >OphauB2|2793
ATGGCTTCTGCGCAAAAGGGCCGTTTGGCCGGCAAAAACGCAATCATTACCGGCGCTGCCGGTGGCATTGGTCTC
GAGACGGCTATTCTCTTCGCCAAAGAGGGCGCCAATGTCATGATGTCGGACATTTCGGCCGAAGCGCTGCAAAAG
GCTCTGGCAAAAGTCCAGCAGCTCGTCCCCGCCGGGCGTGTCGAGACGACGAAATGCGACGTTTCCAAAGAAGCC
GACGTCAAGGCTCTCGTCGAGGCGCTGGATGGCTGGGGCGGCGTCGACGTCATGTTCAACAATGCCGGCATCATG
CACGCCGACGATGCCGATGCCGTTGACACGCCCGAGGCCATTTGGGACTTGACGCAGGCCATCAATGTCAAGGGC
GTCTGGTTTGGCTGCAAGCACGCCGTGCTCTCGCTGCGACGCCACAACAAGACGGCAGGCTCCATCATCAATACC
GCCTCCATTGTTGCCCTGGTGGGCGCCGCCGCGCCTCAGCTCGCCTACACGGCCTCCAAGGGCGCCGTCTTGGCC
CTGACGCGCGAACTTGCCATGGTGCATGCCCGCGAGGGCTTTCGCTTCAATTCGCTCTGTCCGGCGCCGCTAAAC
ACGCCCTTGCTGCAGGACTGGCTGGGCGACGACAAGGCCAAGCGCGCGCGCAGAGAGGTGCATTTCCCAATGGGG
CGCTTTGGCGAGGCGGTTGAGCAGGCTCACGCTGTCGTCTTCTTGGCCAGCAACGAGTCGAGCTTTGTCAATGGC
CATGATTTCGCCGTGGATGGTGGCCTGACCAAGGCCTATGTTACGGCCGAGGGGCCTGCTGCCCGGGCGCCCGCC
AATAATGCTCTCAAGAGCTCGCTCGAATGA
Gene >OphauB2|2793
ATGGCTTCTGCGCAAAAGGGCCGTTTGGCCGGCAAAAACGCAATCATTACCGGCGCTGCCGGGTAAGAGCTTTGG
ACCTTTATGAGATTATGTTTAGCTTCTCTTGTTGCTACGCCCTCGCGCTCGCTGACGACGCGCAGTGGCATTGGT
CTCGAGACGGCTATTCTCTTCGCCAAAGAGGGCGCCAATGTCATGATGTCGGACATTTCGGCCGAAGCGCTGCAA
AAGGCTCTGGCAAAAGTCCAGCAGCTCGTCCCCGCCGGGCGTGTCGAGACGACGGTGTGCTTTTTTTTTTTTTTT
TTTTTTTTTTTCTTTTTTCCCCCCACGTTAACCTTGACTTTTGGTTCCCCCAATTTGCCGCTGCTGCTTGGCTGA
CTGCGCACCCGAGAAATGCGACGTTTCCAAAGAAGCCGACGTCAAGGCTCTCGTCGAGGCGCTGGATGGCTGGGG
CGGCGTCGACGTCATGTTCAACAATGCCGGCATCATGCACGCCGACGATGCCGATGCCGTTGACACGCCCGAGGC
CATTTGGGACTTGACGCAGGCCATCAATGTCAAGGGCGTCTGGTTTGGCTGCAAGCACGCCGTGCTCTCGCTGCG
ACGCCACAACAAGACGGCAGGCTCCATCATCAATACCGCCTCCATTGTTGCCCTGGTGGGCGCCGCCGCGCCTCA
GCTCGCCTACACGGCCTCCAAGGGCGCCGTCTTGGCCCTGACGCGCGAACTTGCCATGGTGCATGCCCGCGAGGG
CTTTCGCTTCAATTCGCTCTGTCCGGCGCCGCTAAACACGCCCTTGCTGCAGGACTGGCTGGGCGACGACAAGGC
CAAGCGCGCGCGCAGAGAGGTGCATTTCCCAATGGGGCGCTTTGGCGAGGCGGTTGAGCAGGCTCACGCTGTCGT
CTTCTTGGCCAGCAACGAGTCGAGCTTTGTCAATGGCCATGATTTCGCCGTGGATGGTGGCCTGACCAAGGCCTA
TGTTACGGCCGAGGGGCCTGCTGCCCGGGCGCCCGCCAATAATGCTCTCAAGAGCTCGCTCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail