Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2775
Gene name
LocationContig_190:7401..8403
Strand+
Gene length (bp)1002
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02517 Rce1-like Type II CAAX prenyl endopeptidase Rce1-like 8.4E-15 117 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 7 260 3.0E-42
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 6 264 2.0E-27
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 3 230 1.0E-26
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 8 235 3.0E-21
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 8 235 3.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94448|RCE1_SCHPO Probable CAAX prenyl protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.02 PE=3 SV=1 7 260 3.0E-42
sp|Q8GW19|FACE2_ARATH CAAX prenyl protease 2 OS=Arabidopsis thaliana GN=FACE2 PE=2 SV=2 6 264 2.0E-27
sp|Q9U1H8|FACE2_DROME CAAX prenyl protease 2 OS=Drosophila melanogaster GN=Sras PE=2 SV=3 3 230 1.0E-26
sp|P57791|FACE2_MOUSE CAAX prenyl protease 2 OS=Mus musculus GN=Rce1 PE=2 SV=1 8 235 3.0E-21
sp|Q9Y256|FACE2_HUMAN CAAX prenyl protease 2 OS=Homo sapiens GN=RCE1 PE=1 SV=1 8 235 3.0E-20
sp|G5EEP3|FACE2_CAEEL CAAX prenyl protease 2 homolog OS=Caenorhabditis elegans GN=fce-2 PE=2 SV=1 25 237 2.0E-15
sp|Q03530|RCE1_YEAST CAAX prenyl protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCE1 PE=1 SV=1 8 228 6.0E-13
sp|A6H7A0|FACE2_BOVIN CAAX prenyl protease 2 OS=Bos taurus GN=RCE1 PE=2 SV=1 8 235 6.0E-12
sp|B0BMW8|FACE2_RAT CAAX prenyl protease 2 OS=Rattus norvegicus GN=Rce1 PE=2 SV=1 8 235 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0071586 CAAX-box protein processing Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0016020 membrane Yes
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0008237 metallopeptidase activity No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0140096 catalytic activity, acting on a protein No
GO:0006807 nitrogen compound metabolic process No
GO:0016485 protein processing No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0051604 protein maturation No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0004175 endopeptidase activity No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 75 97 22
3 142 164 22
4 184 206 22
5 213 232 19
6 252 274 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2775
MVIYCLIYVLPLYAWSATRPSPRRSRDAPDSIRARIRAVSASTFACSLTTFFILHCTHLPSSPLRRMGYWPLGLF
ETVNALFLTALLFAAPIYESLLIDGWWRGWVRLEPLRHLWAHWPTWRNLVAGPITEECLFRAAAVPLLLLAGSET
GLVIFVSPLVFGLAHIHHFYEFCLTHPQTPLAMALVRSLVQLTYTSIFGSYVTFIFLRTGSILAAIFVHILCNAM
GLPRLWGSLEPYWITHRSEPKVWYGPAFISTIVYYSLLLGGATLWWVNLYSLTQSPMALALL*
Coding >OphauB2|2775
ATGGTCATCTACTGCCTCATTTATGTTCTCCCTCTTTACGCTTGGTCTGCTACTAGACCCTCGCCGAGACGCTCC
CGCGACGCCCCTGACTCTATACGCGCTAGAATCAGAGCTGTCTCTGCCTCTACTTTTGCCTGCTCTCTCACTACC
TTCTTCATTCTTCACTGCACTCATCTACCGTCTTCGCCTCTTCGCCGCATGGGCTACTGGCCTCTTGGCCTGTTC
GAGACGGTCAATGCCCTCTTTCTCACTGCTTTGCTTTTTGCCGCGCCCATCTATGAGTCGCTCCTGATTGACGGC
TGGTGGCGCGGCTGGGTGCGTCTAGAACCTCTCCGGCACCTCTGGGCCCATTGGCCAACCTGGCGCAATTTGGTT
GCTGGTCCTATAACTGAAGAATGCCTCTTTCGCGCCGCCGCCGTCCCTCTGCTCCTCCTGGCCGGCTCTGAGACA
GGCTTGGTTATTTTCGTGTCCCCTCTCGTCTTTGGTCTTGCCCACATTCACCACTTTTACGAATTTTGCTTGACC
CATCCTCAGACACCCCTTGCCATGGCTCTCGTCCGTTCCCTTGTTCAACTAACATACACGTCCATCTTTGGATCC
TATGTCACCTTCATTTTCTTGCGAACAGGTTCCATACTTGCCGCCATATTTGTTCACATCCTGTGCAACGCAATG
GGCCTTCCCCGCCTTTGGGGTTCACTGGAGCCCTATTGGATCACTCATCGGAGTGAGCCCAAGGTTTGGTATGGA
CCTGCCTTTATATCAACCATCGTTTACTATTCGCTTTTATTGGGCGGCGCGACGCTGTGGTGGGTCAATCTGTAT
TCACTAACTCAGTCACCCATGGCTCTGGCCCTCTTGTGA
Transcript >OphauB2|2775
ATGGTCATCTACTGCCTCATTTATGTTCTCCCTCTTTACGCTTGGTCTGCTACTAGACCCTCGCCGAGACGCTCC
CGCGACGCCCCTGACTCTATACGCGCTAGAATCAGAGCTGTCTCTGCCTCTACTTTTGCCTGCTCTCTCACTACC
TTCTTCATTCTTCACTGCACTCATCTACCGTCTTCGCCTCTTCGCCGCATGGGCTACTGGCCTCTTGGCCTGTTC
GAGACGGTCAATGCCCTCTTTCTCACTGCTTTGCTTTTTGCCGCGCCCATCTATGAGTCGCTCCTGATTGACGGC
TGGTGGCGCGGCTGGGTGCGTCTAGAACCTCTCCGGCACCTCTGGGCCCATTGGCCAACCTGGCGCAATTTGGTT
GCTGGTCCTATAACTGAAGAATGCCTCTTTCGCGCCGCCGCCGTCCCTCTGCTCCTCCTGGCCGGCTCTGAGACA
GGCTTGGTTATTTTCGTGTCCCCTCTCGTCTTTGGTCTTGCCCACATTCACCACTTTTACGAATTTTGCTTGACC
CATCCTCAGACACCCCTTGCCATGGCTCTCGTCCGTTCCCTTGTTCAACTAACATACACGTCCATCTTTGGATCC
TATGTCACCTTCATTTTCTTGCGAACAGGTTCCATACTTGCCGCCATATTTGTTCACATCCTGTGCAACGCAATG
GGCCTTCCCCGCCTTTGGGGTTCACTGGAGCCCTATTGGATCACTCATCGGAGTGAGCCCAAGGTTTGGTATGGA
CCTGCCTTTATATCAACCATCGTTTACTATTCGCTTTTATTGGGCGGCGCGACGCTGTGGTGGGTCAATCTGTAT
TCACTAACTCAGTCACCCATGGCTCTGGCCCTCTTGTGA
Gene >OphauB2|2775
ATGGTGAGCAATGAGCCTAGCCCATGGCCTCTTGTCCCCTCCATGTGGCTAGCAAGCTCAACTCCCTTTATAGGT
CATCTACTGCCTCATTTATGTTCTCCCTCTTTACGCTTGGTCTGCTACTAGACCCTCGCCGAGACGCTCCCGCGA
CGCCCCTGACTCTATACGCGCTAGAATCAGAGCTGTCTCTGCCTCTACTTTTGCCTGCTCTCTCACTACCTTCTT
CATTCTTCACTGCACTCATCTACCGTCTTCGCCTCTTCGCCGCATGGGCTACTGGCCTCTTGGCCTGTTCGAGAC
GGTCAATGCCCTCTTTCTCACTGCTTTGCTTTTTGCCGCGCCCATCTATGAGTCGCTCCTGATTGACGGCTGGTG
GCGCGGCTGGGTGCGTCTAGAACCTCTCCGGCACCTCTGGGCCCATTGGCCAACCTGGCGCAATTTGGTTGCTGT
ATGAGTACTACTGTTGTCACTATTACATATCTGGAGTGAAACCAAATGGACTGACTTAAGCGTTAGGGTCCTATA
ACTGAAGAATGCCTCTTTCGCGCCGCCGCCGTCCCTCTGCTCCTCCTGGCCGGCTCTGAGACAGGCTTGGTTATT
TTCGTGTCCCCTCTCGTCTTTGGTCTTGCCCACATTCACCACTTTTACGAATTTTGCTTGACCCATCCTCAGACA
CCCCTTGCCATGGCTCTCGTCCGTTCCCTTGTTCAACTAACATACACGTCCATCTTTGGATCCTATGTCACCTTC
ATTTTCTTGCGAACAGGTTCCATACTTGCCGCCATATTTGTTCACATCCTGTGCAACGCAATGGGCCTTCCCCGC
CTTTGGGGTTCACTGGAGCCCTATTGGATCACTCATCGGAGTGAGCCCAAGGTTTGGTATGGACCTGCCTTTATA
TCAACCATCGTTTACTATTCGCTTTTATTGGGCGGCGCGACGCTGTGGTGGGTCAATCTGTATTCACTAACTCAG
TCACCCATGGCTCTGGCCCTCTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail