Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|277
Gene name
LocationContig_100:25215..25758
Strand+
Gene length (bp)543
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03650 MPC Mitochondrial pyruvate carriers 1.2E-34 14 111

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53157|MPC1_YEAST Mitochondrial pyruvate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPC1 PE=1 SV=1 18 112 6.0E-39
sp|O74847|MPC1_SCHPO Probable mitochondrial pyruvate carrier 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpc1 PE=3 SV=3 3 128 4.0E-36
sp|Q7KSC4|MPC1_DROME Mitochondrial pyruvate carrier 1 OS=Drosophila melanogaster GN=Mpc1 PE=3 SV=1 19 110 6.0E-35
sp|P63031|MPC1_RAT Mitochondrial pyruvate carrier 1 OS=Rattus norvegicus GN=Mpc1 PE=3 SV=1 12 101 9.0E-35
sp|P63030|MPC1_MOUSE Mitochondrial pyruvate carrier 1 OS=Mus musculus GN=Mpc1 PE=1 SV=1 12 101 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53157|MPC1_YEAST Mitochondrial pyruvate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPC1 PE=1 SV=1 18 112 6.0E-39
sp|O74847|MPC1_SCHPO Probable mitochondrial pyruvate carrier 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpc1 PE=3 SV=3 3 128 4.0E-36
sp|Q7KSC4|MPC1_DROME Mitochondrial pyruvate carrier 1 OS=Drosophila melanogaster GN=Mpc1 PE=3 SV=1 19 110 6.0E-35
sp|P63031|MPC1_RAT Mitochondrial pyruvate carrier 1 OS=Rattus norvegicus GN=Mpc1 PE=3 SV=1 12 101 9.0E-35
sp|P63030|MPC1_MOUSE Mitochondrial pyruvate carrier 1 OS=Mus musculus GN=Mpc1 PE=1 SV=1 12 101 9.0E-35
sp|Q3ZCG2|MPC1_BOVIN Mitochondrial pyruvate carrier 1 OS=Bos taurus GN=MPC1 PE=1 SV=1 12 101 7.0E-34
sp|Q9Y5U8|MPC1_HUMAN Mitochondrial pyruvate carrier 1 OS=Homo sapiens GN=MPC1 PE=1 SV=1 12 101 8.0E-34
sp|Q2M2T3|MPCX_BOVIN Mitochondrial pyruvate carrier-like protein OS=Bos taurus PE=2 SV=1 12 105 2.0E-29
sp|Q21828|MPC1_CAEEL Probable mitochondrial pyruvate carrier 1 OS=Caenorhabditis elegans GN=R07E5.13 PE=3 SV=2 19 100 4.0E-29
sp|Q949R9|MPC1_ARATH Mitochondrial pyruvate carrier 1 OS=Arabidopsis thaliana GN=MPC1 PE=3 SV=1 23 97 4.0E-26
sp|P0DKB6|MPC1L_HUMAN Mitochondrial pyruvate carrier 1-like protein OS=Homo sapiens GN=MPC1L PE=2 SV=1 1 96 1.0E-24
sp|Q55GU4|MPC1_DICDI Probable mitochondrial pyruvate carrier 1 OS=Dictyostelium discoideum GN=DDB_G0267508 PE=3 SV=2 26 108 1.0E-16
sp|Q09896|MPC2_SCHPO Probable mitochondrial pyruvate carrier 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpc2 PE=3 SV=1 23 102 3.0E-07
sp|O49636|MPC4_ARATH Mitochondrial pyruvate carrier 4 OS=Arabidopsis thaliana GN=MPC4 PE=3 SV=1 23 113 5.0E-07
sp|O95563|MPC2_HUMAN Mitochondrial pyruvate carrier 2 OS=Homo sapiens GN=MPC2 PE=1 SV=1 15 102 6.0E-07
sp|Q8LD38|MPC3_ARATH Mitochondrial pyruvate carrier 3 OS=Arabidopsis thaliana GN=MPC3 PE=2 SV=1 23 82 1.0E-06
sp|Q8L7H8|MPC2_ARATH Mitochondrial pyruvate carrier 2 OS=Arabidopsis thaliana GN=MPC2 PE=3 SV=1 23 100 1.0E-06
sp|P38718|MPC2_RAT Mitochondrial pyruvate carrier 2 OS=Rattus norvegicus GN=Mpc2 PE=2 SV=1 23 102 3.0E-06
sp|Q5R4Z3|MPC2_PONAB Mitochondrial pyruvate carrier 2 OS=Pongo abelii GN=MPC2 PE=2 SV=1 15 102 3.0E-06
sp|Q9D023|MPC2_MOUSE Mitochondrial pyruvate carrier 2 OS=Mus musculus GN=Mpc2 PE=1 SV=1 23 102 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006850 mitochondrial pyruvate transmembrane transport Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0110165 cellular anatomical entity No
GO:0006811 ion transport No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0071702 organic substance transport No
GO:0015718 monocarboxylic acid transport No
GO:0046942 carboxylic acid transport No
GO:1903825 organic acid transmembrane transport No
GO:0006820 anion transport No
GO:0051179 localization No
GO:1905039 carboxylic acid transmembrane transport No
GO:0015711 organic anion transport No
GO:0031966 mitochondrial membrane No
GO:0015849 organic acid transport No
GO:0006810 transport No
GO:1901475 pyruvate transmembrane transport No
GO:0055085 transmembrane transport No
GO:0009987 cellular process No
GO:0019866 organelle inner membrane No
GO:0006848 pyruvate transport No
GO:1990542 mitochondrial transmembrane transport No
GO:0098656 anion transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0031090 organelle membrane No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 49 71 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|277
MASVIKAINAKIRANPMLNYICSTHFWGPVSNFGIPVAAVLDTQKSPDLISGQMTAALCIYSATFMRYALAVTPK
NYLLFACHFVNEGAQLTQGYRYLSYHNWGGKEKMALESGVDAAKNKVQETADKVKDVASKK*
Coding >OphauB2|277
ATGGCGTCCGTGATCAAGGCCATCAACGCCAAAATTAGGGCCAATCCCATGCTCAACTATATCTGTTCGACGCAC
TTTTGGGGGCCCGTTTCGAATTTTGGCATTCCTGTTGCCGCCGTTCTCGATACGCAAAAGAGCCCTGACCTCATC
TCTGGACAGATGACGGCTGCTCTCTGCATATATTCTGCCACCTTTATGCGCTACGCCCTTGCCGTGACGCCCAAA
AATTACCTGCTGTTTGCCTGCCATTTTGTCAACGAGGGTGCGCAGCTCACTCAGGGTTATCGCTATCTGTCATAT
CACAACTGGGGCGGCAAGGAGAAGATGGCTCTCGAGTCTGGCGTTGATGCCGCCAAGAACAAGGTTCAGGAGACG
GCCGACAAGGTCAAGGATGTGGCGAGCAAAAAATAG
Transcript >OphauB2|277
ATGGCGTCCGTGATCAAGGCCATCAACGCCAAAATTAGGGCCAATCCCATGCTCAACTATATCTGTTCGACGCAC
TTTTGGGGGCCCGTTTCGAATTTTGGCATTCCTGTTGCCGCCGTTCTCGATACGCAAAAGAGCCCTGACCTCATC
TCTGGACAGATGACGGCTGCTCTCTGCATATATTCTGCCACCTTTATGCGCTACGCCCTTGCCGTGACGCCCAAA
AATTACCTGCTGTTTGCCTGCCATTTTGTCAACGAGGGTGCGCAGCTCACTCAGGGTTATCGCTATCTGTCATAT
CACAACTGGGGCGGCAAGGAGAAGATGGCTCTCGAGTCTGGCGTTGATGCCGCCAAGAACAAGGTTCAGGAGACG
GCCGACAAGGTCAAGGATGTGGCGAGCAAAAAATAG
Gene >OphauB2|277
ATGGCGTCCGTGATCAAGGCCATCAACGCCAAAATTAGGGCCAATCCCATGCTCAACTATATCTGTTCGACGCGT
GCGTCTTGATGCTGCCTGCTCCGTTCCGTCACAGCGCGAGGCTGACTCTCGAAATATCTATAGACTTTTGGGGGC
CCGTTTCGAATTTTGGCATTCCTGTTGCCGCCGTTCTCGATACGCAAAAGAGCCCTGACCTGTAAGTCACAGTGG
CTGAGGATAGCCGCCACGGTCCCATGCTCACACAGTGGCTTCGCTATACACAGCATCTCTGGACAGATGACGGCT
GCTCTCTGCATATATTCTGCCACCTTTATGCGCTACGCCCTTGCCGTGACGCCCAAAAATTACCTGCTGTTTGCC
TGCCATTTTGTCAACGAGGGTGCGCAGCTCACTCAGGGTTATCGCTATCTGTCATATCACAACTGGGGCGGCAAG
GAGAAGATGGCTCTCGAGTCTGGCGTTGATGCCGCCAAGAACAAGGTTCAGGAGACGGCCGACAAGGTCAAGGAT
GTGGCGAGCAAAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail