Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2766
Gene name
LocationContig_19:214205..215461
Strand+
Gene length (bp)1256
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.5E-55 16 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7SMW7|L2HDH_NEMVE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Nematostella vectensis GN=v1g172254 PE=3 SV=1 16 388 1.0E-29
sp|Q5R9N7|L2HDH_PONAB L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=L2HGDH PE=2 SV=1 25 292 8.0E-26
sp|Q9H9P8|L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=L2HGDH PE=1 SV=3 25 388 8.0E-26
sp|Q9N4Z0|L2HDH_CAEEL L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y45G12B.3 PE=3 SV=2 2 386 3.0E-25
sp|A7MBI3|L2HDH_BOVIN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=L2HGDH PE=2 SV=1 25 292 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7SMW7|L2HDH_NEMVE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Nematostella vectensis GN=v1g172254 PE=3 SV=1 16 388 1.0E-29
sp|Q5R9N7|L2HDH_PONAB L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=L2HGDH PE=2 SV=1 25 292 8.0E-26
sp|Q9H9P8|L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=L2HGDH PE=1 SV=3 25 388 8.0E-26
sp|Q9N4Z0|L2HDH_CAEEL L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y45G12B.3 PE=3 SV=2 2 386 3.0E-25
sp|A7MBI3|L2HDH_BOVIN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=L2HGDH PE=2 SV=1 25 292 5.0E-24
sp|Q91YP0|L2HDH_MOUSE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=L2hgdh PE=1 SV=1 25 388 2.0E-23
sp|A8X2R1|L2HDH_CAEBR L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG06643 PE=3 SV=2 17 386 4.0E-21
sp|Q55GI5|L2HDH_DICDI L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=l2hgdh PE=3 SV=1 16 389 6.0E-21
sp|P37339|LHGO_ECOLI L-2-hydroxyglutarate oxidase LhgO OS=Escherichia coli (strain K12) GN=lhgO PE=1 SV=3 41 382 8.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2766
MGFSTTAKRQADFRHAVIGGGVVGVAIARQLAKRASGTTVLLERHGALGRETTARNSEVVHAGIYYGAKSLKARL
CMRGRELLYALCERHGVGHARVGKWIVAQTAEQRQALQRIYDLSRHELDVPMAWLSEAHVRRHGQGVCAAQGALQ
SPSTGIVDAHGLVMALQGLYQDAGGLVACDSRVTAVTPLGPSSRPGSAGWQLDVCSASSARASVTAESIVNAAGL
GAVNIHNMFVPPHRRRRLYFAKGNYFSYAASSPSISRLIYPAPDPDAAGLGTHLTLDLAGRLRFGPDVEWVDSPH
DLAVTTNRLPLALEQIKKYLPAIDPACLAPDYAGIRPKLTNHAAVVAGTSFNDFYIKLEPGFDACINLLGIESPG
LTSSLAIAEMVEELLYGTVTS*
Coding >OphauB2|2766
ATGGGGTTTAGCACCACGGCCAAGCGGCAAGCCGACTTTAGACACGCGGTGATTGGCGGCGGAGTGGTTGGAGTG
GCGATTGCGCGGCAGCTGGCAAAGCGGGCATCGGGCACGACGGTGCTGCTGGAGCGACACGGGGCGCTGGGCAGG
GAGACGACGGCGCGCAACAGCGAGGTGGTGCACGCAGGCATCTACTACGGGGCCAAGAGCCTCAAGGCGCGGCTG
TGCATGCGCGGGCGCGAGTTGCTGTACGCACTGTGCGAGCGGCACGGCGTCGGCCACGCGCGCGTCGGCAAATGG
ATCGTGGCCCAGACGGCCGAGCAGCGCCAGGCCTTGCAGCGCATCTACGACCTGAGCCGCCACGAGCTCGACGTG
CCCATGGCCTGGCTGTCCGAGGCCCATGTGCGGCGCCATGGCCAGGGCGTATGTGCTGCCCAGGGCGCTCTGCAA
AGCCCCTCGACGGGCATTGTCGATGCCCACGGCCTCGTCATGGCTCTGCAAGGCCTCTACCAGGACGCCGGCGGC
CTTGTCGCCTGCGACTCGCGCGTCACCGCCGTCACTCCCCTCGGCCCCTCCAGTCGCCCCGGCAGTGCCGGCTGG
CAGCTCGACGTCTGCTCTGCCTCGTCGGCCCGAGCCTCCGTCACCGCCGAGAGCATTGTCAATGCTGCCGGCCTC
GGCGCCGTCAACATCCACAACATGTTTGTGCCCCCGCACCGCCGCCGCCGCCTCTATTTTGCCAAGGGCAACTAC
TTTTCCTATGCCGCCTCGAGCCCCTCCATCTCTCGCCTCATCTATCCTGCTCCCGACCCTGACGCTGCCGGCCTC
GGCACTCATCTCACCCTCGATCTCGCCGGCCGTCTGCGCTTCGGCCCAGACGTCGAATGGGTCGACAGCCCCCAC
GACCTGGCCGTCACCACCAATCGTCTGCCTCTCGCCCTCGAGCAAATCAAAAAGTACCTTCCCGCAATCGACCCG
GCCTGCCTCGCCCCCGACTACGCCGGCATCCGCCCCAAGCTCACCAACCACGCTGCCGTCGTTGCTGGTACCTCC
TTCAACGACTTTTACATCAAGCTTGAGCCCGGCTTTGACGCTTGTATCAATCTCCTCGGCATCGAAAGCCCCGGT
CTTACCAGCAGCCTCGCCATTGCTGAAATGGTTGAGGAGCTCCTCTACGGCACTGTCACCTCCTGA
Transcript >OphauB2|2766
ATGGGGTTTAGCACCACGGCCAAGCGGCAAGCCGACTTTAGACACGCGGTGATTGGCGGCGGAGTGGTTGGAGTG
GCGATTGCGCGGCAGCTGGCAAAGCGGGCATCGGGCACGACGGTGCTGCTGGAGCGACACGGGGCGCTGGGCAGG
GAGACGACGGCGCGCAACAGCGAGGTGGTGCACGCAGGCATCTACTACGGGGCCAAGAGCCTCAAGGCGCGGCTG
TGCATGCGCGGGCGCGAGTTGCTGTACGCACTGTGCGAGCGGCACGGCGTCGGCCACGCGCGCGTCGGCAAATGG
ATCGTGGCCCAGACGGCCGAGCAGCGCCAGGCCTTGCAGCGCATCTACGACCTGAGCCGCCACGAGCTCGACGTG
CCCATGGCCTGGCTGTCCGAGGCCCATGTGCGGCGCCATGGCCAGGGCGTATGTGCTGCCCAGGGCGCTCTGCAA
AGCCCCTCGACGGGCATTGTCGATGCCCACGGCCTCGTCATGGCTCTGCAAGGCCTCTACCAGGACGCCGGCGGC
CTTGTCGCCTGCGACTCGCGCGTCACCGCCGTCACTCCCCTCGGCCCCTCCAGTCGCCCCGGCAGTGCCGGCTGG
CAGCTCGACGTCTGCTCTGCCTCGTCGGCCCGAGCCTCCGTCACCGCCGAGAGCATTGTCAATGCTGCCGGCCTC
GGCGCCGTCAACATCCACAACATGTTTGTGCCCCCGCACCGCCGCCGCCGCCTCTATTTTGCCAAGGGCAACTAC
TTTTCCTATGCCGCCTCGAGCCCCTCCATCTCTCGCCTCATCTATCCTGCTCCCGACCCTGACGCTGCCGGCCTC
GGCACTCATCTCACCCTCGATCTCGCCGGCCGTCTGCGCTTCGGCCCAGACGTCGAATGGGTCGACAGCCCCCAC
GACCTGGCCGTCACCACCAATCGTCTGCCTCTCGCCCTCGAGCAAATCAAAAAGTACCTTCCCGCAATCGACCCG
GCCTGCCTCGCCCCCGACTACGCCGGCATCCGCCCCAAGCTCACCAACCACGCTGCCGTCGTTGCTGGTACCTCC
TTCAACGACTTTTACATCAAGCTTGAGCCCGGCTTTGACGCTTGTATCAATCTCCTCGGCATCGAAAGCCCCGGT
CTTACCAGCAGCCTCGCCATTGCTGAAATGGTTGAGGAGCTCCTCTACGGCACTGTCACCTCCTGA
Gene >OphauB2|2766
ATGGGGTTTAGCACCACGGCCAAGCGGCAAGCCGACTTTAGACACGCGGTAAGAGACTTGGGTGGCTCTGCTCTC
TGTGGCGTGGCCAAGCTGACGCAAGAGACACGCAACAGGTGATTGGCGGCGGAGTGGTTGGAGTGGCGATTGCGC
GGCAGCTGGCAAAGCGGGCATCGGGCACGACGGTGCTGCTGGAGCGACACGGGGCGCTGGGCAGGGAGACGACGG
CGCGCAACAGCGAGGTGGTGCACGCAGGCATCTACTACGGGGCCAAGAGCCTCAAGGCGCGGCTGTGCATGCGCG
GGCGCGAGTTGCTGTACGCACTGTGCGAGCGGCACGGCGTCGGCCACGCGCGCGTCGGCAAATGGATCGTGGCCC
AGACGGCCGAGCAGCGCCAGGCCTTGCAGCGCATCTACGACCTGAGCCGCCACGAGCTCGACGTGCCCATGGCCT
GGCTGTCCGAGGCCCATGTGCGGCGCCATGGCCAGGGCGTATGTGCTGCCCAGGGCGCTCTGCAAAGCCCCTCGA
CGGGCATTGTCGATGCCCACGGCCTCGTCATGGCTCTGCAAGGCCTCTACCAGGACGCCGGCGGCCTTGTCGCCT
GCGACTCGCGCGTCACCGCCGTCACTCCCCTCGGCCCCTCCAGTCGCCCCGGCAGTGCCGGCTGGCAGCTCGACG
TCTGCTCTGCCTCGTCGGCCCGAGCCTCCGTCACCGCCGAGAGCATTGTCAATGCTGCCGGCCTCGGCGCCGTCA
ACATCCACAACATGTTTGTGCCCCCGCACCGCCGCCGCCGCCTCTATTTTGCCAAGGGCAACTACTTTTCCTATG
CCGCCTCGAGCCCCTCCATCTCTCGCCTCATCTATCCTGCTCCCGACCCTGACGCTGCCGGCCTCGGCACTCATC
TCACCCTCGATCTCGCCGGCCGTCTGCGCTTCGGCCCAGACGTCGAATGGGTCGACAGCCCCCACGACCTGGCCG
TCACCACCAATCGTCTGCCTCTCGCCCTCGAGCAAATCAAAAAGTACCTTCCCGCAATCGACCCGGCCTGCCTCG
CCCCCGACTACGCCGGCATCCGCCCCAAGCTCACCAACCACGCTGCCGTCGTTGCTGGTACCTCCTTCAACGACT
TTTACATCAAGCTTGAGCCCGGCTTTGACGCTTGTATCAATCTCCTCGGCATCGAAAGCCCCGGTCTTACCAGCA
GCCTCGCCATTGCTGAAATGGTTGAGGAGCTCCTCTACGGCACTGTCACCTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail