Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2752
Gene name
LocationContig_19:176170..177863
Strand+
Gene length (bp)1693
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03941 INCENP_ARK-bind Inner centromere protein, ARK binding region 8.8E-22 440 495

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTN3|PIC1_SCHPO Inner centromere protein-related protein pic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pic1 PE=1 SV=2 435 538 5.0E-15
sp|P38283|SLI15_YEAST Inner centromere protein-related protein SLI15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLI15 PE=1 SV=1 438 495 8.0E-09
sp|Q9NQS7|INCE_HUMAN Inner centromere protein OS=Homo sapiens GN=INCENP PE=1 SV=3 441 514 4.0E-07
sp|Q9WU62|INCE_MOUSE Inner centromere protein OS=Mus musculus GN=Incenp PE=1 SV=2 438 514 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2752
MCTETPKVIKSNSQNNDEIVNCDSKEGTTNDIDMQDASAPSARSVGPCQSVRAAEVKRPVKPAKETQNNTKQAPT
LIRVNMGSQQPQYQGTNRSSFIQETPRYSNSKSQRSLAARTSKASLHGKPPVQSLRGAPPNGRAKALDLAARKRE
QEEREAQRRRDVKAEMDRKRAAVQEDQRKQDTLQRQAKHGRESATSQTEAKRKAAVEKAKHMRAPPPALRTHANN
GRSEAVSAHDRGNSTASSAKGALQNSRPQSRMASNLHRSQDELSRPVNAVLSNTSKTGSKRALGTQDGHIKGQGS
RIGPAYQSNDAKRRRTSAGHDDETETETARNIKGPPVRPSGGLKKDLPARPTYGYTNSSHGVQRDLFKATVTAQH
HNQTKAAHPLDMAQISKGPIPFAPVSIGAGASHKTPARSGGLNMAKSAARSSPRFQNGDSIELPEIDTDDDDEDE
DEAYGTRVAAWADSPDLRRALMRQETMDPSKIFGPAAPLNMEEVFSKSKHSFRARTSSANWSGPDRLTEEEICRD
REARDKLRRDGGWSYEMSREMI*
Coding >OphauB2|2752
ATGTGTACGGAGACGCCCAAGGTGATCAAAAGCAACTCCCAGAACAACGATGAAATTGTCAATTGCGACTCGAAA
GAGGGCACGACCAATGACATCGACATGCAAGATGCCTCTGCTCCCTCGGCTCGTTCAGTTGGTCCATGCCAATCG
GTCCGTGCTGCGGAAGTCAAACGACCAGTCAAGCCGGCCAAAGAAACACAAAACAATACGAAACAGGCTCCCACG
CTGATCAGGGTCAACATGGGATCACAACAGCCTCAATATCAGGGCACAAATAGGTCTTCGTTTATCCAGGAAACA
CCAAGATACTCGAACTCCAAGTCCCAACGAAGTCTTGCTGCTCGTACGAGTAAAGCATCGCTACACGGCAAACCG
CCAGTGCAAAGTTTAAGGGGGGCTCCTCCTAACGGGCGGGCCAAGGCACTGGACTTGGCGGCAAGAAAACGAGAG
CAAGAAGAACGTGAGGCACAACGTCGACGTGATGTCAAGGCGGAGATGGATCGCAAGCGTGCAGCGGTTCAAGAG
GACCAGCGGAAGCAAGACACTCTGCAGCGACAGGCAAAACATGGTCGAGAATCGGCTACAAGCCAAACTGAAGCT
AAGAGAAAGGCAGCAGTGGAAAAGGCCAAGCACATGAGGGCGCCTCCTCCTGCTTTACGAACTCACGCCAACAAT
GGCCGTTCGGAAGCTGTCTCAGCCCACGACCGCGGCAATTCCACAGCTTCGAGTGCTAAGGGAGCGCTACAGAAT
AGCCGGCCACAGTCCCGTATGGCTTCCAACCTGCACCGCTCGCAAGACGAGCTGAGCCGGCCCGTCAATGCAGTT
CTATCAAACACATCCAAGACTGGATCGAAGCGAGCTTTGGGTACCCAAGATGGCCACATTAAGGGACAAGGGTCT
CGGATAGGGCCTGCCTACCAATCCAATGATGCCAAGAGGCGACGAACAAGCGCTGGGCACGACGACGAGACAGAG
ACAGAAACTGCACGGAACATCAAGGGACCTCCCGTGCGGCCGTCAGGTGGCCTAAAGAAGGATCTCCCGGCGAGA
CCAACATATGGGTATACAAACTCGTCTCACGGCGTCCAAAGAGACTTGTTCAAGGCCACGGTTACTGCGCAACAC
CACAACCAGACTAAGGCGGCGCATCCCCTAGACATGGCACAAATCTCAAAGGGTCCAATTCCGTTCGCACCGGTT
AGCATTGGCGCGGGAGCTTCACACAAGACACCAGCTCGTTCTGGAGGACTCAATATGGCAAAATCAGCTGCTCGA
TCATCACCAAGGTTCCAGAACGGAGACTCAATTGAGCTTCCAGAAATTGATACAGATGATGATGATGAGGATGAA
GACGAGGCATATGGAACGCGTGTGGCGGCTTGGGCTGACTCTCCCGATTTGCGACGAGCGCTAATGCGCCAGGAG
ACCATGGACCCTTCCAAAATCTTTGGTCCGGCAGCGCCACTCAATATGGAGGAGGTTTTCAGCAAGAGTAAACAT
AGTTTCCGAGCCAGAACCTCCAGCGCCAACTGGAGCGGACCGGACCGTTTGACCGAAGAGGAGATTTGTCGGGAC
CGTGAGGCTCGAGACAAGCTAAGGCGTGACGGGGGATGGTCTTATGAGATGAGCCGAGAGATGATTTAA
Transcript >OphauB2|2752
ATGTGTACGGAGACGCCCAAGGTGATCAAAAGCAACTCCCAGAACAACGATGAAATTGTCAATTGCGACTCGAAA
GAGGGCACGACCAATGACATCGACATGCAAGATGCCTCTGCTCCCTCGGCTCGTTCAGTTGGTCCATGCCAATCG
GTCCGTGCTGCGGAAGTCAAACGACCAGTCAAGCCGGCCAAAGAAACACAAAACAATACGAAACAGGCTCCCACG
CTGATCAGGGTCAACATGGGATCACAACAGCCTCAATATCAGGGCACAAATAGGTCTTCGTTTATCCAGGAAACA
CCAAGATACTCGAACTCCAAGTCCCAACGAAGTCTTGCTGCTCGTACGAGTAAAGCATCGCTACACGGCAAACCG
CCAGTGCAAAGTTTAAGGGGGGCTCCTCCTAACGGGCGGGCCAAGGCACTGGACTTGGCGGCAAGAAAACGAGAG
CAAGAAGAACGTGAGGCACAACGTCGACGTGATGTCAAGGCGGAGATGGATCGCAAGCGTGCAGCGGTTCAAGAG
GACCAGCGGAAGCAAGACACTCTGCAGCGACAGGCAAAACATGGTCGAGAATCGGCTACAAGCCAAACTGAAGCT
AAGAGAAAGGCAGCAGTGGAAAAGGCCAAGCACATGAGGGCGCCTCCTCCTGCTTTACGAACTCACGCCAACAAT
GGCCGTTCGGAAGCTGTCTCAGCCCACGACCGCGGCAATTCCACAGCTTCGAGTGCTAAGGGAGCGCTACAGAAT
AGCCGGCCACAGTCCCGTATGGCTTCCAACCTGCACCGCTCGCAAGACGAGCTGAGCCGGCCCGTCAATGCAGTT
CTATCAAACACATCCAAGACTGGATCGAAGCGAGCTTTGGGTACCCAAGATGGCCACATTAAGGGACAAGGGTCT
CGGATAGGGCCTGCCTACCAATCCAATGATGCCAAGAGGCGACGAACAAGCGCTGGGCACGACGACGAGACAGAG
ACAGAAACTGCACGGAACATCAAGGGACCTCCCGTGCGGCCGTCAGGTGGCCTAAAGAAGGATCTCCCGGCGAGA
CCAACATATGGGTATACAAACTCGTCTCACGGCGTCCAAAGAGACTTGTTCAAGGCCACGGTTACTGCGCAACAC
CACAACCAGACTAAGGCGGCGCATCCCCTAGACATGGCACAAATCTCAAAGGGTCCAATTCCGTTCGCACCGGTT
AGCATTGGCGCGGGAGCTTCACACAAGACACCAGCTCGTTCTGGAGGACTCAATATGGCAAAATCAGCTGCTCGA
TCATCACCAAGGTTCCAGAACGGAGACTCAATTGAGCTTCCAGAAATTGATACAGATGATGATGATGAGGATGAA
GACGAGGCATATGGAACGCGTGTGGCGGCTTGGGCTGACTCTCCCGATTTGCGACGAGCGCTAATGCGCCAGGAG
ACCATGGACCCTTCCAAAATCTTTGGTCCGGCAGCGCCACTCAATATGGAGGAGGTTTTCAGCAAGAGTAAACAT
AGTTTCCGAGCCAGAACCTCCAGCGCCAACTGGAGCGGACCGGACCGTTTGACCGAAGAGGAGATTTGTCGGGAC
CGTGAGGCTCGAGACAAGCTAAGGCGTGACGGGGGATGGTCTTATGAGATGAGCCGAGAGATGATTTAA
Gene >OphauB2|2752
ATGTGTACGGAGACGCCCAAGGTGATCAAAAGCAACTCCCAGAACAACGATGAAATTGTCAATTGCGACTCGAAA
GAGGGCACGACCAATGACATCGACATGCAAGATGCCTCTGCTCCCTCGGCTCGTTCAGTTGGTCCATGCCAATCG
GTCCGTGCTGCGGAAGTCAAACGACCAGTCAAGCCGGCCAAAGAAACACAAAACAATACGAAACAGGCTCCCACG
CTGATCAGGGTCAACATGGGATCACAACAGCCTCAATATCAGGGCACAAATAGGTCTTCGTTTATCCAGGAAACA
CCAAGATACTCGAACTCCAAGTCCCAACGAAGTCTTGCTGCTCGTACGAGTAAAGCATCGCTACACGGCAAACCG
CCAGTGCAAAGTTTAAGGGGGGCTCCTCCTAACGGGCGGGCCAAGGCACTGGACTTGGCGGCAAGAAAACGAGAG
CAAGAAGAACGTGAGGCACAACGTCGACGTGATGTCAAGGCGGAGATGGATCGCAAGCGTGCAGCGGTTCAAGAG
GACCAGCGGAAGCAAGACACTCTGCAGCGACAGGCAAAACATGGTCGAGAATCGGCTACAAGCCAAACTGAAGCT
AAGAGAAAGGCAGCAGTGGAAAAGGCCAAGCACATGAGGGCGCCTCCTCCTGCTTTACGAACTCACGCCAACAAT
GGCCGTTCGGAAGCTGTCTCAGCCCACGACCGCGGCAATTCCACAGCTTCGAGTGCTAAGGGAGCGCTACAGAAT
AGCCGGCCACAGTCCCGTATGGCTTCCAACCTGCACCGCTCGCAAGACGAGCTGAGCCGGCCCGTCAATGCAGTT
CTATCAAACACATCCAAGACTGGATCGAAGCGAGCTTTGGGTACCCAAGATGGCCACATTAAGGGACAAGGGTCT
CGGATAGGGCCTGCCTACCAATCCAATGATGCCAAGAGGCGACGAACAAGCGCTGGGCACGACGACGAGACAGAG
ACAGAAACTGCACGGAACATCAAGGGACCTCCCGTGCGGCCGTCAGGTGGCCTAAAGAAGGTAAGTTGCAAAGTG
TGAGCCTGACAAGATTGAAGCTAATGAGAGGAAGGATCTCCCGGCGAGACCAACATATGGGTATACAAACTCGTC
TCACGGCGTCCAAAGAGACTTGTTCAAGGCCACGGTTACTGCGCAACACCACAACCAGACTAAGGCGGCGCATCC
CCTAGACATGGCACAAATCTCAAAGGGTCCAATTCCGTTCGCACCGGTTAGCATTGGCGCGGGAGCTTCACACAA
GACACCAGCTCGTTCTGGAGGACTCAATATGGCAAAATCAGCTGCTCGATCATCACCAAGGTTCCAGAACGGAGA
CTCAATTGAGCTTCCAGAAATTGATACAGATGATGATGATGAGGATGAAGACGAGGCATATGGAACGCGTGTGGC
GGCTTGGGCTGACTCTCCCGATTTGCGACGAGCGCTAATGCGCCAGGAGACCATGGACCCTTCCAAAATCTTTGG
TCCGGCAGCGCCACTCAATATGGAGGAGGTTTTCAGCAAGAGTAAACATAGTTTCCGAGCCAGAACCTCCAGCGC
CAACTGGAGCGGACCGGACCGTTTGACCGAAGAGGAGATTTGTCGGGACCGTGAGGCTCGAGACAAGCTAAGGCG
TGACGGGGGATGGTCTTATGAGATGAGCCGAGAGATGATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail