Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2743
Gene name
LocationContig_19:153193..153842
Strand-
Gene length (bp)649
Transcript length (bp)576
Coding sequence length (bp)576
Protein length (aa) 192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02845 CUE CUE domain 9.0E-09 49 86

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6BKU8|CUE1_DEBHA Coupling of ubiquitin conjugation to ER degradation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CUE1 PE=3 SV=1 50 187 9.0E-09

GO

GO Term Description Terminal node
GO:0043130 ubiquitin binding Yes
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2743
MPDDQISLPYLAAILIITGLILRYFFFSTPATPQPRTSPETVMRSRELAVEHIQQMFPQADRRNILWDLQRNGGN
MQATSERILAGRLETPPVTFQPAPPPGQIVAAGASAATGATTRQTDRLVQQPDLITRYNLKGKLNEESEESGRTS
KGWSSNRNERQESLQRRRDDMILMARRKMEAKMAAEVTEGS*
Coding >OphauB2|2743
ATGCCGGACGACCAGATTTCGCTGCCATACTTGGCGGCCATTCTCATCATCACCGGACTAATACTGCGCTATTTC
TTCTTCTCGACTCCCGCAACCCCTCAACCTAGGACGTCACCGGAGACCGTCATGAGGTCACGCGAGTTGGCAGTC
GAGCATATACAGCAAATGTTTCCGCAAGCTGATAGAAGAAACATTCTTTGGGATCTACAGCGAAACGGTGGCAAT
ATGCAGGCAACGAGCGAACGGATTCTAGCGGGGCGTTTGGAGACTCCACCTGTTACGTTTCAGCCCGCACCGCCT
CCAGGGCAGATAGTAGCAGCAGGAGCAAGTGCTGCTACGGGAGCAACGACGAGACAGACAGATCGGCTTGTGCAG
CAGCCCGACTTAATCACGCGTTACAATCTCAAGGGGAAGCTGAATGAAGAGTCAGAAGAGTCAGGTCGCACTAGC
AAAGGCTGGAGCTCAAATCGCAATGAGAGGCAGGAATCGCTACAGCGGAGACGCGATGACATGATTTTGATGGCA
CGTCGCAAAATGGAGGCCAAGATGGCCGCTGAGGTGACAGAAGGGAGCTGA
Transcript >OphauB2|2743
ATGCCGGACGACCAGATTTCGCTGCCATACTTGGCGGCCATTCTCATCATCACCGGACTAATACTGCGCTATTTC
TTCTTCTCGACTCCCGCAACCCCTCAACCTAGGACGTCACCGGAGACCGTCATGAGGTCACGCGAGTTGGCAGTC
GAGCATATACAGCAAATGTTTCCGCAAGCTGATAGAAGAAACATTCTTTGGGATCTACAGCGAAACGGTGGCAAT
ATGCAGGCAACGAGCGAACGGATTCTAGCGGGGCGTTTGGAGACTCCACCTGTTACGTTTCAGCCCGCACCGCCT
CCAGGGCAGATAGTAGCAGCAGGAGCAAGTGCTGCTACGGGAGCAACGACGAGACAGACAGATCGGCTTGTGCAG
CAGCCCGACTTAATCACGCGTTACAATCTCAAGGGGAAGCTGAATGAAGAGTCAGAAGAGTCAGGTCGCACTAGC
AAAGGCTGGAGCTCAAATCGCAATGAGAGGCAGGAATCGCTACAGCGGAGACGCGATGACATGATTTTGATGGCA
CGTCGCAAAATGGAGGCCAAGATGGCCGCTGAGGTGACAGAAGGGAGCTGA
Gene >OphauB2|2743
ATGCCGGACGACCAGATTTCGCTGCCATACTTGGCGGCCATTCTCATCATCACCGGACTAATACTGCGCTATTTC
TTCTTCTCGACTCCCGCAACCCCTCAACCTAGGACGTCACCGGAGACCGTCATGAGGTCACGCGAGTTGGCAGTC
GAGCATATACAGCAAATGTTTCCGCAAGCTGATAGAAGAAACATTCTTTGGGATCTACAGCGAAACGGTGGCAAT
ATGCAGGCAACGAGCGAACGGATTCTAGCGGGGCGTTTGGAGACTGTACGTCGGCCTTGCGCATGGGTGTCTTGG
TTGAGTGTTCTGTGTGTCTCGGGCTGATAAGAGTCTTGCATAGCCACCTGTTACGTTTCAGCCCGCACCGCCTCC
AGGGCAGATAGTAGCAGCAGGAGCAAGTGCTGCTACGGGAGCAACGACGAGACAGACAGATCGGCTTGTGCAGCA
GCCCGACTTAATCACGCGTTACAATCTCAAGGGGAAGCTGAATGAAGAGTCAGAAGAGTCAGGTCGCACTAGCAA
AGGCTGGAGCTCAAATCGCAATGAGAGGCAGGAATCGCTACAGCGGAGACGCGATGACATGATTTTGATGGCACG
TCGCAAAATGGAGGCCAAGATGGCCGCTGAGGTGACAGAAGGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail