Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2740
Gene name
LocationContig_19:143099..146365
Strand-
Gene length (bp)3266
Transcript length (bp)3063
Coding sequence length (bp)3063
Protein length (aa) 1021

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12812 PDZ_1 PDZ-like domain 2.5E-34 399 474
PF12812 PDZ_1 PDZ-like domain 1.8E-17 873 950
PF13365 Trypsin_2 Trypsin-like peptidase domain 8.2E-19 110 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S1|YIFC_SCHPO PDZ domain-containing protein C23G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23G3.12c PE=2 SV=1 77 997 0.0E+00
sp|A4RJH4|NM111_MAGO7 Pro-apoptotic serine protease NMA111 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NMA111 PE=3 SV=1 1 1016 0.0E+00
sp|Q6CIT6|NM111_KLULA Pro-apoptotic serine protease NMA111 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NMA111 PE=3 SV=1 76 984 0.0E+00
sp|A7TGI3|NM111_VANPO Pro-apoptotic serine protease NMA111 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NMA111 PE=3 SV=1 77 991 0.0E+00
sp|A6ZRW1|NM111_YEAS7 Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain YJM789) GN=NMA111 PE=3 SV=1 78 998 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7S1|YIFC_SCHPO PDZ domain-containing protein C23G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23G3.12c PE=2 SV=1 77 997 0.0E+00
sp|A4RJH4|NM111_MAGO7 Pro-apoptotic serine protease NMA111 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NMA111 PE=3 SV=1 1 1016 0.0E+00
sp|Q6CIT6|NM111_KLULA Pro-apoptotic serine protease NMA111 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NMA111 PE=3 SV=1 76 984 0.0E+00
sp|A7TGI3|NM111_VANPO Pro-apoptotic serine protease NMA111 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NMA111 PE=3 SV=1 77 991 0.0E+00
sp|A6ZRW1|NM111_YEAS7 Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain YJM789) GN=NMA111 PE=3 SV=1 78 998 0.0E+00
sp|P53920|NM111_YEAST Pro-apoptotic serine protease NMA111 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMA111 PE=1 SV=1 78 998 0.0E+00
sp|Q75D90|NM111_ASHGO Pro-apoptotic serine protease NMA111 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NMA111 PE=3 SV=2 66 986 0.0E+00
sp|A3LX99|NM111_PICST Pro-apoptotic serine protease NMA111 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NMA111 PE=3 SV=1 11 983 0.0E+00
sp|Q6FLE2|NM111_CANGA Pro-apoptotic serine protease NMA111 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NMA111 PE=3 SV=1 77 1002 0.0E+00
sp|A5DVI0|NM111_LODEL Pro-apoptotic serine protease NMA111 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NMA111 PE=3 SV=1 60 985 0.0E+00
sp|Q6BKM0|NM111_DEBHA Pro-apoptotic serine protease NMA111 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NMA111 PE=3 SV=2 6 997 0.0E+00
sp|A5DAL3|NM111_PICGU Pro-apoptotic serine protease NMA111 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NMA111 PE=3 SV=2 36 988 0.0E+00
sp|A1DP85|NM111_NEOFI Pro-apoptotic serine protease nma111 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nma111 PE=3 SV=2 11 1004 0.0E+00
sp|Q2H334|NM111_CHAGB Pro-apoptotic serine protease NMA111 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NMA111 PE=3 SV=1 1 1010 0.0E+00
sp|Q7S9D2|NM111_NEUCR Pro-apoptotic serine protease nma111 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nma111 PE=3 SV=1 1 1010 0.0E+00
sp|Q4WLG1|NM111_ASPFU Pro-apoptotic serine protease nma111 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nma111 PE=3 SV=1 11 1004 0.0E+00
sp|Q6BZQ9|NM111_YARLI Pro-apoptotic serine protease NMA111 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NMA111 PE=3 SV=2 64 1020 0.0E+00
sp|Q0CSC0|NM111_ASPTN Pro-apoptotic serine protease nma111 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nma111 PE=3 SV=2 9 1004 0.0E+00
sp|Q2TYB1|NM111_ASPOR Pro-apoptotic serine protease nma111 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nma111 PE=3 SV=1 1 1004 0.0E+00
sp|A5AB13|NM111_ASPNC Pro-apoptotic serine protease nma111 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nma111 PE=3 SV=2 9 1004 0.0E+00
sp|A1CUK5|NM111_ASPCL Pro-apoptotic serine protease nma111 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nma111 PE=3 SV=1 11 1004 0.0E+00
sp|Q1E3N5|NM111_COCIM Pro-apoptotic serine protease NMA111 OS=Coccidioides immitis (strain RS) GN=NMA111 PE=3 SV=2 76 1004 0.0E+00
sp|A6RG85|NM111_AJECN Pro-apoptotic serine protease NMA111 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NMA111 PE=3 SV=2 77 997 0.0E+00
sp|Q0UY70|NM111_PHANO Pro-apoptotic serine protease NMA111 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NMA111 PE=3 SV=2 3 997 0.0E+00
sp|O74325|YH05_SCHPO PDZ domain-containing protein C1685.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1685.05 PE=4 SV=1 68 986 6.0E-142
sp|Q8RY22|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana GN=DEGP7 PE=2 SV=1 77 538 2.0E-105
sp|Q8RY22|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana GN=DEGP7 PE=2 SV=1 567 993 3.0E-53
sp|P72780|HHOA_SYNY3 Putative serine protease HhoA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hhoA PE=1 SV=1 106 400 1.0E-14
sp|Q6BZQ9|NM111_YARLI Pro-apoptotic serine protease NMA111 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NMA111 PE=3 SV=2 33 484 1.0E-13
sp|E1V4H2|DEGPL_HALED Probable periplasmic serine endoprotease DegP-like OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=mucD PE=3 SV=1 108 395 3.0E-10
sp|Q6GMI0|HTR1A_DANRE Serine protease HTRA1A OS=Danio rerio GN=htra1a PE=2 SV=1 80 391 1.0E-09
sp|P45129|HTOA_HAEIN Probable periplasmic serine protease do/HhoA-like OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1259 PE=3 SV=1 110 393 2.0E-09
sp|P83110|HTRA3_HUMAN Serine protease HTRA3 OS=Homo sapiens GN=HTRA3 PE=1 SV=2 59 391 2.0E-09
sp|P0C0V0|DEGP_ECOLI Periplasmic serine endoprotease DegP OS=Escherichia coli (strain K12) GN=degP PE=1 SV=1 110 393 2.0E-09
sp|P0C0V1|DEGP_ECO57 Periplasmic serine endoprotease DegP OS=Escherichia coli O157:H7 GN=degP PE=3 SV=1 110 393 2.0E-09
sp|F1N152|HTRA1_BOVIN Serine protease HTRA1 OS=Bos taurus GN=HTRA1 PE=2 SV=1 65 391 3.0E-09
sp|D3ZA76|HTRA3_RAT Serine protease HTRA3 OS=Rattus norvegicus GN=Htra3 PE=2 SV=1 59 391 3.0E-09
sp|Q9D236|HTRA3_MOUSE Serine protease HTRA3 OS=Mus musculus GN=Htra3 PE=1 SV=3 59 391 3.0E-09
sp|P26982|DEGP_SALTY Periplasmic serine endoprotease DegP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=degP PE=3 SV=1 110 393 5.0E-09
sp|P54925|DEGPL_BARHE Probable periplasmic serine endoprotease DegP-like OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=htrA PE=3 SV=2 110 392 5.0E-09
sp|A6YFB5|HTRA1_XENLA Serine protease HTRA1 OS=Xenopus laevis GN=htra1 PE=1 SV=1 80 391 1.0E-08
sp|P39099|DEGQ_ECOLI Periplasmic pH-dependent serine endoprotease DegQ OS=Escherichia coli (strain K12) GN=degQ PE=1 SV=1 82 391 1.0E-08
sp|P73354|HTRA_SYNY3 Putative serine protease HtrA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=htrA PE=1 SV=1 110 401 1.0E-08
sp|Q9VFJ3|HTRA2_DROME Serine protease HTRA2, mitochondrial OS=Drosophila melanogaster GN=HtrA2 PE=1 SV=1 80 391 2.0E-08
sp|B1J4D7|DEGPL_PSEPW Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain W619) GN=PputW619_1070 PE=3 SV=1 108 477 2.0E-08
sp|B4HEM8|HTRA2_DROSE Serine protease HTRA2, mitochondrial OS=Drosophila sechellia GN=HtrA2 PE=3 SV=1 80 391 2.0E-08
sp|Q2SL36|DEGPL_HAHCH Probable periplasmic serine endoprotease DegP-like OS=Hahella chejuensis (strain KCTC 2396) GN=mucD PE=3 SV=1 108 396 4.0E-08
sp|A4XSC0|DEGPL_PSEMY Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas mendocina (strain ymp) GN=Pmen_1471 PE=3 SV=1 108 396 5.0E-08
sp|A5W8F5|DEGPL_PSEP1 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=Pput_4291 PE=3 SV=1 108 477 6.0E-08
sp|Q9PL97|DEGPL_CHLMU Probable periplasmic serine endoprotease DegP-like OS=Chlamydia muridarum (strain MoPn / Nigg) GN=htrA PE=3 SV=1 110 470 9.0E-08
sp|B3P3J9|HTRA2_DROER Serine protease HTRA2, mitochondrial OS=Drosophila erecta GN=HtrA2 PE=3 SV=1 80 391 1.0E-07
sp|Q48EU9|DEGPL_PSE14 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mucD PE=3 SV=1 108 472 1.0E-07
sp|Q89AP5|DEGPL_BUCBP Probable periplasmic serine endoprotease DegP-like OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=htrA PE=3 SV=1 77 472 1.0E-07
sp|A4IHA1|HTRA1_XENTR Serine protease HTRA1 OS=Xenopus tropicalis GN=htra1 PE=2 SV=2 80 391 2.0E-07
sp|B3LVG7|HTRA2_DROAN Serine protease HTRA2, mitochondrial OS=Drosophila ananassae GN=HtrA2 PE=3 SV=1 80 391 2.0E-07
sp|B0KV30|DEGPL_PSEPG Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas putida (strain GB-1) GN=PputGB1_4377 PE=3 SV=1 108 477 3.0E-07
sp|P73940|HHOB_SYNY3 Putative serine protease HhoB OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hhoB PE=1 SV=1 94 383 4.0E-07
sp|D3ZKF5|HTRA4_RAT Serine protease HTR4 OS=Rattus norvegicus GN=Htra4 PE=3 SV=1 82 372 5.0E-07
sp|P83105|HTRA4_HUMAN Serine protease HTRA4 OS=Homo sapiens GN=HTRA4 PE=2 SV=1 82 391 5.0E-07
sp|A2RT60|HTRA4_MOUSE Serine protease HTRA4 OS=Mus musculus GN=Htra4 PE=2 SV=1 82 359 9.0E-07
sp|Q4KGQ4|DEGPL_PSEF5 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mucD PE=3 SV=1 108 477 9.0E-07
sp|Q9R9I1|HTRB_BACSU Serine protease Do-like HtrB OS=Bacillus subtilis (strain 168) GN=htrB PE=2 SV=1 113 385 1.0E-06
sp|B4N937|HTRA2_DROWI Serine protease HTRA2, mitochondrial OS=Drosophila willistoni GN=HtrA2 PE=3 SV=1 80 391 1.0E-06
sp|P18584|DEGPL_CHLTR Probable periplasmic serine endoprotease DegP-like OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=htrA PE=3 SV=2 110 469 2.0E-06
sp|Q9JIY5|HTRA2_MOUSE Serine protease HTRA2, mitochondrial OS=Mus musculus GN=Htra2 PE=1 SV=2 80 391 3.0E-06
sp|P05676|Y938_SYNP6 Uncharacterized serine protease syc0938_d OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=syc0938_d PE=3 SV=2 109 397 5.0E-06
sp|A0JNK3|HTRA2_BOVIN Serine protease HTRA2, mitochondrial OS=Bos taurus GN=HTRA2 PE=2 SV=1 80 358 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2740
MNGSRPALSGKRRAASSPSSDNAPPVKRTLNGRLSADDNTPDCGYADFDDSSDLSHADGPHGLVPPMYIGTPGSL
GEWQDTIQKVVRNVVAIRFCQTCSFDTDPALTSEATGFVVDSERGYIMTNRHVVGAGPFWGHCVFDNHEEVDCYP
VYRDPVHDFGILRYDPKAIKYMHVDGLDLRPDLAKVGVEIRVVGNDAGEKLSILSGVISRLDRNAPEYGEGYSDF
NTCYYQANAAASGGSSGSPVVSKDGSAVALQAGGRCDGPSTDYFLPLDRPLRALKCIQQGKPVTRGDIQCQFLLK
PFDECRRLGLSPEWEAAMRKAFPDETNMLVAEIILPSGPSHLKIEEGDVLIKVNGELITQFIRLDDILDSNAGKT
IKFQLQRGGQNVQVEIEVGDLHGITPDRFVSVAGASFHNLSYQQARLYAVAVQGVFVCESAGSFRFDTSDHGWII
HTVDHKKVPDLDTFVQVMKTIPDKARVVVTYKHLRDLHTLNTSVLYIDRHWSSKMKLAVRNDQTGMWDFTDLGDA
LPPVAPVRRSASFIELDHMPHPGIAELIRSFVHVNCTMPMKLDGFPKNRRWGMGLVIDADKGLVLISRAIVPYDL
CDITVTIADSIFVEAKVIFLHPLQNYAIIKYDPSLVDAPVKSARMSDQHLAQGAKTYFVGYNRIGRVVHGSTTVT
EITAVAIPANSGAPRYRAVNVDAITIDSNLGSTCNSGVLVASDGTVQALWLSYLGERSPCSQRDEEYYLGLGTPT
LLPVISTVQRGETPQLRMLSVELRSVQMAQARVMGVSDEWIKKVTEANPSHHQLFMVSKRTFERGEHPVSLVEGD
IVLKLNGKMCTTISDFDVMYSTDVLDAVIVRECEELHLRLPTVAAKDMETDRAVSFCGAVLHRPHHAVRQQISKL
HSEVYVSSRIRGSPAYQYGVAPTNFITHVNGRSTPNLESFIEATRQIPDNTYFRLKAVTFDSVPWVITMKKNDHY
FPTVEWIKDCNEECGWRRVTYEGTKVVEGESTEGVPPMAEDTEME*
Coding >OphauB2|2740
ATGAACGGCTCACGGCCTGCACTCTCGGGCAAGCGACGAGCAGCGTCCTCTCCTTCCTCAGACAACGCGCCACCT
GTTAAGCGAACGCTCAACGGCCGACTGTCTGCCGACGACAACACACCCGACTGTGGGTATGCCGACTTTGACGAC
AGCTCAGATCTGTCGCATGCAGACGGGCCGCACGGCCTTGTACCGCCCATGTATATTGGGACGCCGGGAAGCCTG
GGCGAGTGGCAGGACACGATCCAGAAGGTGGTTCGCAACGTGGTTGCGATTCGCTTCTGCCAGACGTGTTCCTTT
GATACAGACCCGGCTCTGACCAGTGAGGCCACGGGCTTTGTTGTAGACTCAGAGCGAGGGTACATCATGACGAAT
CGCCACGTTGTCGGCGCGGGCCCCTTCTGGGGTCATTGCGTCTTCGATAATCACGAAGAAGTTGACTGCTACCCG
GTATACCGCGACCCCGTTCACGATTTCGGAATTCTGCGCTACGATCCCAAAGCTATCAAGTATATGCATGTTGAC
GGCCTTGACCTGAGGCCAGATCTAGCAAAAGTCGGTGTCGAGATTCGAGTTGTTGGCAACGATGCCGGCGAGAAG
CTCAGTATCCTATCAGGCGTCATCAGTCGCCTCGACCGTAATGCTCCCGAATACGGCGAGGGATACAGCGACTTC
AATACGTGCTACTATCAGGCCAATGCCGCCGCCAGTGGAGGCAGCTCTGGCAGCCCCGTCGTCAGCAAGGATGGC
TCGGCTGTGGCCCTTCAGGCCGGTGGTCGATGCGACGGACCCTCAACCGACTATTTTCTCCCCTTGGATCGCCCG
CTACGCGCCCTCAAATGCATCCAGCAGGGCAAGCCCGTCACTCGTGGCGACATACAGTGCCAGTTCTTGCTTAAG
CCTTTTGATGAATGTCGTCGGCTAGGTCTCAGTCCTGAGTGGGAGGCTGCTATGCGCAAGGCGTTTCCAGATGAA
ACCAACATGCTGGTGGCTGAGATTATTCTGCCCTCTGGTCCTTCGCATCTCAAGATTGAAGAAGGCGATGTGCTC
ATCAAAGTCAATGGGGAACTCATTACTCAGTTTATCAGGTTAGACGACATTCTTGACTCCAATGCAGGCAAGACA
ATCAAGTTCCAGCTTCAACGCGGTGGCCAGAACGTCCAAGTGGAGATTGAGGTTGGCGACCTTCATGGCATCACG
CCCGATCGCTTCGTCTCTGTTGCTGGCGCCAGCTTCCACAATCTGTCGTACCAGCAAGCCAGACTTTACGCAGTG
GCCGTACAGGGCGTATTCGTTTGCGAATCCGCTGGCTCATTCCGCTTTGACACATCGGACCATGGCTGGATCATC
CACACGGTCGACCACAAAAAGGTGCCAGATTTAGACACGTTTGTCCAGGTCATGAAGACGATTCCTGACAAGGCC
AGAGTGGTGGTGACGTACAAGCATCTGCGTGACCTACACACGCTCAATACATCCGTCTTGTACATTGACCGCCAC
TGGTCCTCCAAGATGAAGCTGGCAGTGCGAAACGACCAGACGGGCATGTGGGATTTTACAGATCTGGGGGACGCG
CTGCCGCCAGTCGCGCCGGTACGCCGGTCGGCCTCGTTTATCGAGCTCGACCACATGCCCCATCCGGGCATTGCG
GAGCTGATTCGGAGCTTCGTCCACGTCAACTGCACCATGCCCATGAAACTCGACGGCTTCCCTAAGAATAGACGT
TGGGGCATGGGTCTCGTCATTGATGCGGACAAGGGCCTGGTGCTCATCTCACGAGCCATTGTGCCATATGACCTT
TGCGACATTACTGTCACTATTGCTGATTCTATTTTTGTCGAGGCAAAGGTTATATTCCTGCACCCGCTACAAAAC
TACGCCATCATCAAGTACGACCCGTCGCTTGTCGATGCGCCCGTCAAGAGCGCCAGGATGAGTGACCAGCACCTG
GCGCAAGGAGCCAAGACGTATTTTGTCGGCTACAATAGGATTGGTCGCGTGGTACACGGCTCAACGACGGTGACA
GAAATCACTGCTGTTGCCATACCAGCCAACTCGGGGGCGCCTCGCTACCGCGCTGTCAATGTTGACGCCATTACC
ATTGATAGCAACCTGGGATCTACGTGCAACAGCGGTGTCCTCGTTGCGTCGGACGGCACCGTCCAGGCGCTTTGG
CTGTCGTATCTGGGCGAGAGGTCACCCTGTAGCCAGCGTGACGAGGAGTACTATCTTGGCTTGGGCACGCCAACG
TTGCTGCCCGTCATCTCGACGGTTCAGCGCGGCGAGACGCCGCAGCTGCGCATGCTGTCGGTCGAGCTGCGGTCG
GTGCAAATGGCTCAGGCGCGCGTCATGGGCGTATCAGACGAATGGATTAAAAAGGTGACTGAGGCCAATCCCTCT
CACCATCAGCTCTTCATGGTTAGCAAGAGGACCTTTGAGCGCGGCGAGCACCCCGTCTCCCTGGTCGAGGGCGAC
ATTGTGCTCAAGCTCAACGGCAAGATGTGCACCACTATATCCGACTTTGATGTCATGTACTCGACGGATGTGCTC
GACGCCGTCATTGTTCGCGAATGTGAAGAATTGCATCTACGGCTACCGACAGTGGCGGCTAAGGACATGGAGACG
GATCGGGCCGTATCTTTTTGTGGTGCTGTTCTCCATCGTCCACATCACGCTGTGCGTCAACAGATCAGCAAGCTG
CACAGCGAGGTGTATGTATCGAGCCGTATTCGAGGTTCTCCGGCATATCAGTACGGCGTTGCCCCTACTAACTTT
ATCACGCACGTCAACGGACGGTCCACACCAAATCTCGAGTCATTTATCGAGGCTACACGGCAGATTCCCGACAAT
ACCTATTTTCGGCTCAAGGCTGTCACATTCGATAGCGTGCCGTGGGTCATCACCATGAAGAAGAATGATCACTAC
TTCCCAACGGTGGAATGGATCAAAGACTGCAATGAGGAGTGTGGATGGCGGCGCGTTACTTACGAAGGAACCAAG
GTGGTCGAGGGCGAATCGACCGAGGGTGTACCGCCCATGGCTGAGGATACCGAAATGGAGTAA
Transcript >OphauB2|2740
ATGAACGGCTCACGGCCTGCACTCTCGGGCAAGCGACGAGCAGCGTCCTCTCCTTCCTCAGACAACGCGCCACCT
GTTAAGCGAACGCTCAACGGCCGACTGTCTGCCGACGACAACACACCCGACTGTGGGTATGCCGACTTTGACGAC
AGCTCAGATCTGTCGCATGCAGACGGGCCGCACGGCCTTGTACCGCCCATGTATATTGGGACGCCGGGAAGCCTG
GGCGAGTGGCAGGACACGATCCAGAAGGTGGTTCGCAACGTGGTTGCGATTCGCTTCTGCCAGACGTGTTCCTTT
GATACAGACCCGGCTCTGACCAGTGAGGCCACGGGCTTTGTTGTAGACTCAGAGCGAGGGTACATCATGACGAAT
CGCCACGTTGTCGGCGCGGGCCCCTTCTGGGGTCATTGCGTCTTCGATAATCACGAAGAAGTTGACTGCTACCCG
GTATACCGCGACCCCGTTCACGATTTCGGAATTCTGCGCTACGATCCCAAAGCTATCAAGTATATGCATGTTGAC
GGCCTTGACCTGAGGCCAGATCTAGCAAAAGTCGGTGTCGAGATTCGAGTTGTTGGCAACGATGCCGGCGAGAAG
CTCAGTATCCTATCAGGCGTCATCAGTCGCCTCGACCGTAATGCTCCCGAATACGGCGAGGGATACAGCGACTTC
AATACGTGCTACTATCAGGCCAATGCCGCCGCCAGTGGAGGCAGCTCTGGCAGCCCCGTCGTCAGCAAGGATGGC
TCGGCTGTGGCCCTTCAGGCCGGTGGTCGATGCGACGGACCCTCAACCGACTATTTTCTCCCCTTGGATCGCCCG
CTACGCGCCCTCAAATGCATCCAGCAGGGCAAGCCCGTCACTCGTGGCGACATACAGTGCCAGTTCTTGCTTAAG
CCTTTTGATGAATGTCGTCGGCTAGGTCTCAGTCCTGAGTGGGAGGCTGCTATGCGCAAGGCGTTTCCAGATGAA
ACCAACATGCTGGTGGCTGAGATTATTCTGCCCTCTGGTCCTTCGCATCTCAAGATTGAAGAAGGCGATGTGCTC
ATCAAAGTCAATGGGGAACTCATTACTCAGTTTATCAGGTTAGACGACATTCTTGACTCCAATGCAGGCAAGACA
ATCAAGTTCCAGCTTCAACGCGGTGGCCAGAACGTCCAAGTGGAGATTGAGGTTGGCGACCTTCATGGCATCACG
CCCGATCGCTTCGTCTCTGTTGCTGGCGCCAGCTTCCACAATCTGTCGTACCAGCAAGCCAGACTTTACGCAGTG
GCCGTACAGGGCGTATTCGTTTGCGAATCCGCTGGCTCATTCCGCTTTGACACATCGGACCATGGCTGGATCATC
CACACGGTCGACCACAAAAAGGTGCCAGATTTAGACACGTTTGTCCAGGTCATGAAGACGATTCCTGACAAGGCC
AGAGTGGTGGTGACGTACAAGCATCTGCGTGACCTACACACGCTCAATACATCCGTCTTGTACATTGACCGCCAC
TGGTCCTCCAAGATGAAGCTGGCAGTGCGAAACGACCAGACGGGCATGTGGGATTTTACAGATCTGGGGGACGCG
CTGCCGCCAGTCGCGCCGGTACGCCGGTCGGCCTCGTTTATCGAGCTCGACCACATGCCCCATCCGGGCATTGCG
GAGCTGATTCGGAGCTTCGTCCACGTCAACTGCACCATGCCCATGAAACTCGACGGCTTCCCTAAGAATAGACGT
TGGGGCATGGGTCTCGTCATTGATGCGGACAAGGGCCTGGTGCTCATCTCACGAGCCATTGTGCCATATGACCTT
TGCGACATTACTGTCACTATTGCTGATTCTATTTTTGTCGAGGCAAAGGTTATATTCCTGCACCCGCTACAAAAC
TACGCCATCATCAAGTACGACCCGTCGCTTGTCGATGCGCCCGTCAAGAGCGCCAGGATGAGTGACCAGCACCTG
GCGCAAGGAGCCAAGACGTATTTTGTCGGCTACAATAGGATTGGTCGCGTGGTACACGGCTCAACGACGGTGACA
GAAATCACTGCTGTTGCCATACCAGCCAACTCGGGGGCGCCTCGCTACCGCGCTGTCAATGTTGACGCCATTACC
ATTGATAGCAACCTGGGATCTACGTGCAACAGCGGTGTCCTCGTTGCGTCGGACGGCACCGTCCAGGCGCTTTGG
CTGTCGTATCTGGGCGAGAGGTCACCCTGTAGCCAGCGTGACGAGGAGTACTATCTTGGCTTGGGCACGCCAACG
TTGCTGCCCGTCATCTCGACGGTTCAGCGCGGCGAGACGCCGCAGCTGCGCATGCTGTCGGTCGAGCTGCGGTCG
GTGCAAATGGCTCAGGCGCGCGTCATGGGCGTATCAGACGAATGGATTAAAAAGGTGACTGAGGCCAATCCCTCT
CACCATCAGCTCTTCATGGTTAGCAAGAGGACCTTTGAGCGCGGCGAGCACCCCGTCTCCCTGGTCGAGGGCGAC
ATTGTGCTCAAGCTCAACGGCAAGATGTGCACCACTATATCCGACTTTGATGTCATGTACTCGACGGATGTGCTC
GACGCCGTCATTGTTCGCGAATGTGAAGAATTGCATCTACGGCTACCGACAGTGGCGGCTAAGGACATGGAGACG
GATCGGGCCGTATCTTTTTGTGGTGCTGTTCTCCATCGTCCACATCACGCTGTGCGTCAACAGATCAGCAAGCTG
CACAGCGAGGTGTATGTATCGAGCCGTATTCGAGGTTCTCCGGCATATCAGTACGGCGTTGCCCCTACTAACTTT
ATCACGCACGTCAACGGACGGTCCACACCAAATCTCGAGTCATTTATCGAGGCTACACGGCAGATTCCCGACAAT
ACCTATTTTCGGCTCAAGGCTGTCACATTCGATAGCGTGCCGTGGGTCATCACCATGAAGAAGAATGATCACTAC
TTCCCAACGGTGGAATGGATCAAAGACTGCAATGAGGAGTGTGGATGGCGGCGCGTTACTTACGAAGGAACCAAG
GTGGTCGAGGGCGAATCGACCGAGGGTGTACCGCCCATGGCTGAGGATACCGAAATGGAGTAA
Gene >OphauB2|2740
ATGAACGGCTCACGGCCTGCACTCTCGGGCAAGCGACGAGCAGCGTCCTCTCCTTCCTCAGACAACGCGCCACCT
GTTAAGCGAACGCTCAACGGCCGACTGTCTGCCGACGACAACACACCCGACTGTGGGTATGCCGACTTTGACGAC
AGCTCAGATCTGTCGCATGCAGACGGGCCGCACGGCCTTGTACCGCCCATGTATATTGGGACGCCGGGAAGCCTG
GGCGAGTGGCAGGACACGATCCAGAAGGTGGTTCGCAACGTGGTTGCGATTCGCTTCTGCCAGACGTGTTCCTTT
GATACAGACCCGGCTCTGACCAGTGAGGCCACGGGCTTTGTTGTAGACTCAGAGCGAGGGTGAGGCGCCACTTAG
CCATGTCGTTGCAACTCTTGACAGATCCGTGTCTGCTGACATGGCTCCTGGTGCTCAGGTACATCATGACGAATC
GCCACGTTGTCGGCGCGGGCCCCTTCTGGGGTCATTGCGTCTTCGATAATCACGAAGAAGTTGACTGCTACCCGG
TATACCGCGACCCCGTTCACGATTTCGGAATTCTGCGCTACGATCCCAAAGCTATCAAGTATATGCATGTTGACG
GCCTTGACCTGAGGCCAGATCTAGCAAAAGGTATGGTGACACTTGCTGCCCTGTGCCCTATTCCTATTCCTTGAT
CAAGCAGCTAACAGCAATGCAACCCAGTCGGTGTCGAGATTCGAGTTGTTGGCAACGATGCCGGCGAGAAGCTCA
GTATCCTATCAGGCGTCATCAGTCGCCTCGACCGTAATGCTCCCGAATACGGCGAGGGATACAGCGACTTCAATA
CGTGCTACTATCAGGCCAATGCCGCCGCCAGTGGAGGCAGCTCTGGCAGCCCCGTCGTCAGCAAGGATGGCTCGG
CTGTGGCCCTTCAGGCCGGTGGTCGATGCGACGGACCCTCAACCGACTATTTTCTCCCCTTGGATCGCCCGCTAC
GCGCCCTCAAATGCATCCAGCAGGGCAAGCCCGTCACTCGTGGCGACATACAGTGCCAGTTCTTGCTTAAGCCTT
TTGATGAATGTCGTCGGCTAGGTCTCAGTCCTGAGTGGGAGGCTGCTATGCGCAAGGCGTTTCCAGATGAAACCA
ACATGCTGGTGGCTGAGATTATTCTGCCCTCTGGTCCTTCGCATCTCAAGATTGAAGAAGGCGATGTGCTCATCA
AAGTCAATGGGGAACTCATTACTCAGTTTATCAGGTTAGACGACATTCTTGACTCCAATGCAGGCAAGACAATCA
AGTTCCAGCTTCAACGCGGTGGCCAGAACGTCCAAGTGGAGATTGAGGTTGGCGACCTTCATGGCATCACGCCCG
ATCGCTTCGTCTCTGTTGCTGGCGCCAGCTTCCACAATCTGTCGTACCAGCAAGCCAGACTTTACGCAGTGGCCG
TACAGGGCGTATTCGTTTGCGAATCCGCTGGCTCATTCCGCTTTGACACATCGGACCATGGCTGGATCATCCACA
CGGTCGACCACAAAAAGGTGCCAGATTTAGACACGTTTGTCCAGGTCATGAAGACGATTCCTGACAAGGCCAGAG
TGGTGGTGACGTACAAGCATCTGCGTGACCTACACACGCTCAATACATCCGTCTTGTACATTGACCGCCACTGGT
CCTCCAAGATGAAGCTGGCAGTGCGAAACGACCAGACGGGCATGTGGGATTTTACAGATCTGGGGGACGCGCTGC
CGCCAGTCGCGCCGGTACGCCGGTCGGCCTCGTTTATCGAGCTCGACCACATGCCCCATCCGGGCATTGCGGAGC
TGATTCGGAGCTTCGTCCACGTCAACTGCACCATGCCCATGAAACTCGACGGCTTCCCTAAGAATAGACGTTGGG
GCATGGGTCTCGTCATTGATGCGGACAAGGGCCTGGTGCTCATCTCACGAGCCATTGTGCCATATGACCTTTGCG
ACATTACTGTCACTATTGCTGATTCTATTTTTGTCGAGGCAAAGGTTATATTCCTGCACCCGCTACAAAACTACG
CCATCATCAAGTACGACCCGTCGCTTGTCGATGCGCCCGTCAAGAGCGCCAGGATGAGTGACCAGCACCTGGCGC
AAGGAGCCAAGACGTATTTTGTCGGCTACAATAGGATTGGTCGCGTGGTACACGGCTCAACGACGGTGACAGAAA
TCACTGCTGTTGCCATACCAGCCAACTCGGGGGCGCCTCGCTACCGCGCTGTCAATGTTGACGCCATTACCATTG
ATAGCAACCTGGGATCTACGTGCAACAGCGGTGTCCTCGTTGCGTCGGACGGCACCGTCCAGGCGCTTTGGCTGT
CGTATCTGGGCGAGAGGTCACCCTGTAGCCAGCGTGACGAGGAGTACTATCTTGGCTTGGGCACGCCAACGTTGC
TGCCCGTCATCTCGACGGTTCAGCGCGGCGAGACGCCGCAGCTGCGCATGCTGTCGGTCGAGCTGCGGTCGGTGC
AAATGGCTCAGGCGCGCGTCATGGGCGTATCAGACGAATGGATTAAAAAGGTGACTGAGGCCAATCCCTCTCACC
ATCAGCTCTTCATGGTTAGCAAGAGGACCTTTGAGCGCGGCGAGCACCCCGTCTCCCTGGTCGAGGGCGACATTG
TGCTCAAGCTCAACGGCAAGATGTGCACCACTATATCCGACTTTGATGTCATGTACTCGACGGATGTGCTCGACG
CCGTCATTGTTCGCGAATGTGAAGAATTGCATCTACGGCTACCGACAGTGGCGGCTAAGGACATGGAGACGGATC
GGGCCGTATCTTTTTGTGGTGCTGTTCTCCATCGTCCACATCACGCTGTGCGTCAACAGATCAGCAAGCTGCACA
GCGAGGTGTATGTATCGAGCCGTATTCGAGGTTCTCCGGCATATCAGTACGGCGTTGCCCCTACTAACTTTATCA
CGCACGTCAACGGACGGTCCACACCAAATCTCGAGTCATTTATCGAGGCTACACGGCAGATTCCCGACAATACCT
GTAAGTGGCCCACCCTCGTCTCGATTTTTCGGATTGCTGACAAGAGACACGTCACAGATTTTCGGCTCAAGGCTG
TCACATTCGATAGCGTGCCGTGGGTCATCACCATGAAGAAGAATGATCACTACTTCCCAACGGTGGAATGGATCA
AAGACTGCAATGAGGAGTGTGGATGGCGGCGCGTTACTTACGAAGGAACCAAGGTGGTCGAGGGCGAATCGACCG
AGGGTGTACCGCCCATGGCTGAGGATACCGAAATGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail