Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2739
Gene name
LocationContig_19:141261..142258
Strand-
Gene length (bp)997
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway 2.3E-59 12 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ZBV1|IST1_BOVIN IST1 homolog OS=Bos taurus GN=IST1 PE=2 SV=1 10 184 6.0E-36
sp|P53990|IST1_HUMAN IST1 homolog OS=Homo sapiens GN=IST1 PE=1 SV=1 10 174 7.0E-36
sp|Q568Z6|IST1_RAT IST1 homolog OS=Rattus norvegicus GN=Ist1 PE=2 SV=1 10 185 9.0E-36
sp|Q9CX00|IST1_MOUSE IST1 homolog OS=Mus musculus GN=Ist1 PE=1 SV=1 10 185 1.0E-35
sp|Q5R6G8|IST1_PONAB IST1 homolog OS=Pongo abelii GN=IST1 PE=2 SV=1 10 174 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ZBV1|IST1_BOVIN IST1 homolog OS=Bos taurus GN=IST1 PE=2 SV=1 10 184 6.0E-36
sp|P53990|IST1_HUMAN IST1 homolog OS=Homo sapiens GN=IST1 PE=1 SV=1 10 174 7.0E-36
sp|Q568Z6|IST1_RAT IST1 homolog OS=Rattus norvegicus GN=Ist1 PE=2 SV=1 10 185 9.0E-36
sp|Q9CX00|IST1_MOUSE IST1 homolog OS=Mus musculus GN=Ist1 PE=1 SV=1 10 185 1.0E-35
sp|Q5R6G8|IST1_PONAB IST1 homolog OS=Pongo abelii GN=IST1 PE=2 SV=1 10 174 9.0E-35
sp|P53843|IST1_YEAST Vacuolar protein sorting-associated protein IST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST1 PE=1 SV=1 2 172 2.0E-29
sp|Q54I39|IST1L_DICDI IST1-like protein OS=Dictyostelium discoideum GN=DDB_G0289029 PE=3 SV=1 10 174 1.0E-28
sp|O74490|IST1_SCHPO Vacuolar protein sorting-associated protein ist1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ist1 PE=3 SV=1 8 176 3.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0071705 nitrogen compound transport No
GO:0008150 biological_process No
GO:0033036 macromolecule localization No
GO:0008104 protein localization No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0045184 establishment of protein localization No
GO:0070727 cellular macromolecule localization No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2739
MPAQAPLVTKLKVQLKLAIARLRMVQQRDEQLGKTQRRAMAQLLEAGKIESATIRVEGIIRSDIISELHEILELY
CELLLARSGLLEGPVCDAGLEEAVKSIMYAAPRTEIKELVVVRQLLGEKYGKEFAREAMDNVGDKVSDKVMRKLS
VEPPRPELVQGYLEEIAKAYGVDWPRGSLARSAPAEPEPLDSRQDDQDQEGYGGGNGSSGTPAQKASQQTATSEP
QDTSRTEQVNLKQPTPPNENAGTPRSPLTVTPPRMTTDNVHPKVTLGSVELKPGSGRAAATPRNKEPEGSVPDIG
DLERRFAALKKR*
Coding >OphauB2|2739
ATGCCCGCGCAGGCACCGCTCGTGACCAAGCTCAAAGTACAGCTAAAGCTGGCCATTGCACGGCTCCGAATGGTG
CAGCAGCGAGACGAGCAGCTCGGCAAGACACAGCGGCGAGCCATGGCTCAGCTCCTAGAAGCGGGCAAGATTGAG
TCTGCGACGATCCGAGTAGAGGGAATCATTCGATCCGACATTATTAGCGAGCTGCACGAGATTCTCGAGCTCTAT
TGCGAGCTCTTGTTGGCGCGGTCAGGTTTGCTCGAGGGGCCAGTGTGTGATGCAGGACTTGAAGAGGCGGTCAAG
AGTATCATGTACGCAGCTCCACGAACAGAGATCAAGGAACTTGTCGTTGTCAGACAGCTGCTAGGTGAAAAATAT
GGCAAAGAGTTTGCGCGCGAAGCCATGGATAACGTGGGAGACAAGGTCAGCGACAAGGTGATGCGCAAGCTAAGT
GTCGAGCCGCCGCGGCCGGAGCTGGTGCAGGGCTATCTCGAAGAAATTGCAAAGGCATATGGCGTTGACTGGCCG
CGGGGTTCACTGGCAAGGTCAGCTCCAGCTGAGCCTGAACCCCTCGACTCGCGTCAAGACGATCAAGACCAAGAG
GGCTATGGAGGCGGCAATGGCAGCTCGGGAACACCAGCGCAAAAGGCTTCACAACAGACTGCTACGTCGGAGCCG
CAAGATACATCTCGAACAGAGCAAGTCAATCTAAAACAGCCAACTCCACCTAATGAAAACGCTGGAACACCCAGA
AGCCCGTTGACTGTAACGCCGCCGCGCATGACGACGGACAATGTGCATCCCAAAGTCACGCTAGGCTCTGTTGAG
CTCAAGCCTGGCAGTGGTAGAGCTGCTGCTACTCCGCGAAACAAGGAACCAGAGGGATCTGTACCAGATATTGGT
GATTTGGAGAGGCGATTTGCTGCTTTAAAGAAAAGGTGA
Transcript >OphauB2|2739
ATGCCCGCGCAGGCACCGCTCGTGACCAAGCTCAAAGTACAGCTAAAGCTGGCCATTGCACGGCTCCGAATGGTG
CAGCAGCGAGACGAGCAGCTCGGCAAGACACAGCGGCGAGCCATGGCTCAGCTCCTAGAAGCGGGCAAGATTGAG
TCTGCGACGATCCGAGTAGAGGGAATCATTCGATCCGACATTATTAGCGAGCTGCACGAGATTCTCGAGCTCTAT
TGCGAGCTCTTGTTGGCGCGGTCAGGTTTGCTCGAGGGGCCAGTGTGTGATGCAGGACTTGAAGAGGCGGTCAAG
AGTATCATGTACGCAGCTCCACGAACAGAGATCAAGGAACTTGTCGTTGTCAGACAGCTGCTAGGTGAAAAATAT
GGCAAAGAGTTTGCGCGCGAAGCCATGGATAACGTGGGAGACAAGGTCAGCGACAAGGTGATGCGCAAGCTAAGT
GTCGAGCCGCCGCGGCCGGAGCTGGTGCAGGGCTATCTCGAAGAAATTGCAAAGGCATATGGCGTTGACTGGCCG
CGGGGTTCACTGGCAAGGTCAGCTCCAGCTGAGCCTGAACCCCTCGACTCGCGTCAAGACGATCAAGACCAAGAG
GGCTATGGAGGCGGCAATGGCAGCTCGGGAACACCAGCGCAAAAGGCTTCACAACAGACTGCTACGTCGGAGCCG
CAAGATACATCTCGAACAGAGCAAGTCAATCTAAAACAGCCAACTCCACCTAATGAAAACGCTGGAACACCCAGA
AGCCCGTTGACTGTAACGCCGCCGCGCATGACGACGGACAATGTGCATCCCAAAGTCACGCTAGGCTCTGTTGAG
CTCAAGCCTGGCAGTGGTAGAGCTGCTGCTACTCCGCGAAACAAGGAACCAGAGGGATCTGTACCAGATATTGGT
GATTTGGAGAGGCGATTTGCTGCTTTAAAGAAAAGGTGA
Gene >OphauB2|2739
ATGCCCGCGCAGGCACCGCTCGTGGTACGTCTCAGGTATATAACAGCCACAAATTCCAATTACACACTAACGCGA
ACTCCAGACCAAGCTCAAAGTACAGCTAAAGCTGGCCATTGCACGGCTCCGAATGGTGCAGCAGCGAGACGAGCA
GCTCGGCAAGACACAGCGGCGAGCCATGGCTCAGCTCCTAGAAGCGGGCAAGATTGAGTCTGCGACGATCCGAGT
AGAGGGAATCATTCGATCCGACATTATTAGCGAGCTGCACGAGATTCTCGAGCTCTATTGCGAGCTCTTGTTGGC
GCGGTCAGGTTTGCTCGAGGGGCCAGTGTGTGATGCAGGACTTGAAGAGGCGGTCAAGAGTATCATGTACGCAGC
TCCACGAACAGAGATCAAGGAACTTGTCGTTGTCAGACAGCTGCTAGGTGAAAAATATGGCAAAGAGTTTGCGCG
CGAAGCCATGGATAACGTGGGAGACAAGGTCAGCGACAAGGTGATGCGCAAGCTAAGTGTCGAGCCGCCGCGGCC
GGAGCTGGTGCAGGGCTATCTCGAAGAAATTGCAAAGGCATATGGCGTTGACTGGCCGCGGGGTTCACTGGCAAG
GTCAGCTCCAGCTGAGCCTGAACCCCTCGACTCGCGTCAAGACGATCAAGACCAAGAGGGCTATGGAGGCGGCAA
TGGCAGCTCGGGAACACCAGCGCAAAAGGCTTCACAACAGACTGCTACGTCGGAGCCGCAAGATACATCTCGAAC
AGAGCAAGTCAATCTAAAACAGCCAACTCCACCTAATGAAAACGCTGGAACACCCAGAAGCCCGTTGACTGTAAC
GCCGCCGCGCATGACGACGGACAATGTGCATCCCAAAGTCACGCTAGGCTCTGTTGAGCTCAAGCCTGGCAGTGG
TAGAGCTGCTGCTACTCCGCGAAACAAGGAACCAGAGGGATCTGTACCAGATATTGGTGATTTGGAGAGGCGATT
TGCTGCTTTAAAGAAAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail