Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2736
Gene name
LocationContig_19:134450..135733
Strand-
Gene length (bp)1283
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 43 262 2.0E-31

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2736
MAVVAFAAVSGSSPAYEVFYKRLVAFLIGALVAMVVEVVVTPVQNATSHALLARFNHARDRAQDALNAAETFLPD
CLNEPRLKGSFKPLAPIYQEIIYVLQQIVDRTDGVVQLRGAYGSTVLEGLYAQVFAYRRNVAASSALILFSISGA
LVTRLPLPQFIPSARVAQLRLINHVRGLVMAEHKGKQSANAREQQAGDLYALDEETADMITERKFLSWNATTAGQ
MEIIEYLEELVELVKLLVGVNAFRSGMLERPKYGEYARRVDDAQLSSGAEPLGHATSRHSSSQGMEEQRQWSAAR
DATSGPLRTRATVGPGISRRRTWADTEAAVDTEGGDEDEGIPCSLQRVGTRLRQDSAVVRRRATYMIGGGEAA*
Coding >OphauB2|2736
ATGGCCGTTGTTGCTTTTGCTGCGGTTAGCGGGAGCTCTCCAGCATACGAAGTTTTCTATAAGCGTCTAGTGGCC
TTTCTGATAGGAGCCCTGGTAGCCATGGTTGTTGAAGTTGTGGTGACGCCAGTTCAAAATGCAACGAGCCATGCG
CTGCTTGCTCGATTTAACCACGCCCGTGATCGAGCACAAGATGCCCTAAACGCCGCAGAGACATTTCTACCAGAT
TGTCTCAACGAGCCACGCCTCAAGGGCAGCTTCAAGCCGCTAGCACCCATTTACCAGGAAATTATTTATGTTCTT
CAGCAAATCGTGGACCGTACGGACGGCGTTGTACAGCTGCGCGGGGCGTACGGCTCGACTGTGCTTGAAGGCTTG
TATGCCCAAGTTTTTGCCTATCGCCGAAACGTGGCGGCCAGCAGCGCCTTGATTCTCTTTTCGATAAGCGGAGCC
TTGGTAACGCGTCTTCCTCTACCACAGTTTATACCGTCGGCCCGCGTCGCGCAGCTGCGGCTTATAAATCATGTG
CGTGGACTTGTCATGGCAGAGCACAAGGGAAAGCAGAGCGCGAATGCCCGAGAGCAGCAGGCCGGGGACCTATAT
GCTCTGGACGAGGAGACGGCCGACATGATTACCGAGCGCAAGTTCTTGTCGTGGAACGCCACCACGGCTGGCCAG
ATGGAAATCATTGAGTATTTGGAGGAGCTAGTGGAGCTGGTTAAGCTTTTGGTGGGTGTCAATGCCTTTCGAAGT
GGCATGCTGGAGCGCCCAAAGTATGGAGAGTATGCGCGGCGCGTAGACGATGCCCAGCTCTCTTCAGGCGCGGAA
CCTCTGGGTCACGCGACATCACGTCATTCAAGCAGTCAAGGGATGGAGGAGCAAAGGCAATGGTCGGCGGCTCGC
GACGCCACCTCTGGGCCCCTGCGTACCAGAGCAACCGTGGGGCCTGGAATTTCACGTCGGCGCACATGGGCGGAT
ACCGAGGCCGCCGTGGATACCGAGGGCGGGGATGAAGACGAGGGAATCCCGTGCAGCCTACAGCGAGTGGGCACT
CGGCTGCGCCAGGACAGCGCTGTGGTGAGGCGGCGGGCGACGTACATGATTGGTGGTGGTGAAGCAGCGTAG
Transcript >OphauB2|2736
ATGGCCGTTGTTGCTTTTGCTGCGGTTAGCGGGAGCTCTCCAGCATACGAAGTTTTCTATAAGCGTCTAGTGGCC
TTTCTGATAGGAGCCCTGGTAGCCATGGTTGTTGAAGTTGTGGTGACGCCAGTTCAAAATGCAACGAGCCATGCG
CTGCTTGCTCGATTTAACCACGCCCGTGATCGAGCACAAGATGCCCTAAACGCCGCAGAGACATTTCTACCAGAT
TGTCTCAACGAGCCACGCCTCAAGGGCAGCTTCAAGCCGCTAGCACCCATTTACCAGGAAATTATTTATGTTCTT
CAGCAAATCGTGGACCGTACGGACGGCGTTGTACAGCTGCGCGGGGCGTACGGCTCGACTGTGCTTGAAGGCTTG
TATGCCCAAGTTTTTGCCTATCGCCGAAACGTGGCGGCCAGCAGCGCCTTGATTCTCTTTTCGATAAGCGGAGCC
TTGGTAACGCGTCTTCCTCTACCACAGTTTATACCGTCGGCCCGCGTCGCGCAGCTGCGGCTTATAAATCATGTG
CGTGGACTTGTCATGGCAGAGCACAAGGGAAAGCAGAGCGCGAATGCCCGAGAGCAGCAGGCCGGGGACCTATAT
GCTCTGGACGAGGAGACGGCCGACATGATTACCGAGCGCAAGTTCTTGTCGTGGAACGCCACCACGGCTGGCCAG
ATGGAAATCATTGAGTATTTGGAGGAGCTAGTGGAGCTGGTTAAGCTTTTGGTGGGTGTCAATGCCTTTCGAAGT
GGCATGCTGGAGCGCCCAAAGTATGGAGAGTATGCGCGGCGCGTAGACGATGCCCAGCTCTCTTCAGGCGCGGAA
CCTCTGGGTCACGCGACATCACGTCATTCAAGCAGTCAAGGGATGGAGGAGCAAAGGCAATGGTCGGCGGCTCGC
GACGCCACCTCTGGGCCCCTGCGTACCAGAGCAACCGTGGGGCCTGGAATTTCACGTCGGCGCACATGGGCGGAT
ACCGAGGCCGCCGTGGATACCGAGGGCGGGGATGAAGACGAGGGAATCCCGTGCAGCCTACAGCGAGTGGGCACT
CGGCTGCGCCAGGACAGCGCTGTGGTGAGGCGGCGGGCGACGTACATGATTGGTGGTGGTGAAGCAGCGTAG
Gene >OphauB2|2736
ATGGCCGTTGTTGCTTTTGGTAAGGTGTTGAGCACTTTATGAATGACTTTTACAAGCAACGCTGTGACTAACGTG
GAGCAGCTGCGGTTAGCGGGAGCTCTCCAGCATACGAAGTTTTCTATAAGCGTCTAGTGGCCTTTCTGATAGGAG
CCCTGGTAGCCATGGTTGTTGAAGTTGTGGTGACGCCAGTTCGTGCTAGAGATTGTCTAGTGAAGTCCTTGTCGG
ACTCTCTTGACCACATTCAGAAAATGCAACGAGCCATGTATGTTGGCATTGACGGCCCGGAGAGACCTGACTTAC
AGTCACAGGCGCTGCTTGCTCGATTTAACCACGCCCGTGATCGAGCACAAGATGCCCTAAACGCCGCAGAGACAT
TTCTACCAGATTGTCTCAACGAGCCACGCCTCAAGGGCAGCTTCAAGCCGCTAGCACCCATTTACCAGGAAATTA
TTTATGTTCTTCAGCAAATCGTGGACCGTACGGACGGCGTTGTACAGCTGCGCGGGGCGTACGGCTCGACTGTGC
TTGAAGGCTTGTATGCCCAAGTTTTTGCCTATCGCCGAAACGTGGCGGCCAGCAGCGCCTTGATTCTCTTTTCGA
TAAGCGGAGCCTTGGTAACGCGTCTTCCTCTACCACAGTTTATACCGTCGGCCCGCGTCGCGCAGCTGCGGCTTA
TAAATCATGTGCGTGGACTTGTCATGGCAGAGCACAAGGGAAAGCAGAGCGCGAATGCCCGAGAGCAGCAGGCCG
GGGACCTATATGCTCTGGACGAGGAGACGGCCGACATGATTACCGAGCGCAAGTTCTTGTCGTGGAACGCCACCA
CGGCTGGCCAGATGGAAATCATTGAGTATTTGGAGGAGCTAGTGGAGCTGGTTAAGCTTTTGGTGGGTGTCAATG
CCTTTCGAAGTGGCATGCTGGAGCGCCCAAAGTATGGAGAGTATGCGCGGCGCGTAGACGATGCCCAGCTCTCTT
CAGGCGCGGAACCTCTGGGTCACGCGACATCACGTCATTCAAGCAGTCAAGGGATGGAGGAGCAAAGGCAATGGT
CGGCGGCTCGCGACGCCACCTCTGGGCCCCTGCGTACCAGAGCAACCGTGGGGCCTGGAATTTCACGTCGGCGCA
CATGGGCGGATACCGAGGCCGCCGTGGATACCGAGGGCGGGGATGAAGACGAGGGAATCCCGTGCAGCCTACAGC
GAGTGGGCACTCGGCTGCGCCAGGACAGCGCTGTGGTGAGGCGGCGGGCGACGTACATGATTGGTGGTGGTGAAG
CAGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail