Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2734
Gene name
LocationContig_19:131079..132231
Strand+
Gene length (bp)1152
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04072 LCM Leucine carboxyl methyltransferase 3.0E-23 38 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ICG8|LCMT1_GIBZE Leucine carboxyl methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPM1 PE=3 SV=1 1 338 4.0E-106
sp|Q7SAP7|LCMT1_NEUCR Leucine carboxyl methyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppm-1 PE=3 SV=2 30 332 2.0E-80
sp|Q5AQJ2|LCMT1_EMENI Leucine carboxyl methyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppm1 PE=3 SV=2 30 335 4.0E-74
sp|Q4WS57|LCMT1_ASPFU Leucine carboxyl methyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppm1 PE=3 SV=1 23 329 1.0E-67
sp|O94257|LCMT1_SCHPO Leucine carboxyl methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppm1 PE=3 SV=1 33 339 2.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ICG8|LCMT1_GIBZE Leucine carboxyl methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPM1 PE=3 SV=1 1 338 4.0E-106
sp|Q7SAP7|LCMT1_NEUCR Leucine carboxyl methyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ppm-1 PE=3 SV=2 30 332 2.0E-80
sp|Q5AQJ2|LCMT1_EMENI Leucine carboxyl methyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppm1 PE=3 SV=2 30 335 4.0E-74
sp|Q4WS57|LCMT1_ASPFU Leucine carboxyl methyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppm1 PE=3 SV=1 23 329 1.0E-67
sp|O94257|LCMT1_SCHPO Leucine carboxyl methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppm1 PE=3 SV=1 33 339 2.0E-53
sp|Q6C997|LCMT1_YARLI Leucine carboxyl methyltransferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPM1 PE=3 SV=1 30 334 6.0E-49
sp|Q6BQD2|LCMT1_DEBHA Leucine carboxyl methyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPM1 PE=3 SV=2 30 342 2.0E-41
sp|Q5XIA3|TYW4_RAT tRNA wybutosine-synthesizing protein 4 OS=Rattus norvegicus GN=Lcmt2 PE=2 SV=1 18 348 4.0E-39
sp|O60294|TYW4_HUMAN tRNA wybutosine-synthesizing protein 4 OS=Homo sapiens GN=LCMT2 PE=1 SV=3 18 338 2.0E-36
sp|Q5A387|LCMT1_CANAL Leucine carboxyl methyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPM1 PE=3 SV=1 67 330 9.0E-36
sp|Q9UIC8|LCMT1_HUMAN Leucine carboxyl methyltransferase 1 OS=Homo sapiens GN=LCMT1 PE=1 SV=2 30 332 3.0E-35
sp|P0CO56|LCMT1_CRYNJ Leucine carboxyl methyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPM1 PE=3 SV=1 40 339 2.0E-34
sp|P0CO57|LCMT1_CRYNB Leucine carboxyl methyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PPM1 PE=3 SV=1 40 339 3.0E-34
sp|Q8BYR1|TYW4_MOUSE tRNA wybutosine-synthesizing protein 4 OS=Mus musculus GN=Lcmt2 PE=2 SV=4 18 332 5.0E-34
sp|P46554|LCMT1_CAEEL Probable leucine carboxyl methyltransferase 1 OS=Caenorhabditis elegans GN=B0285.4 PE=3 SV=1 22 330 5.0E-34
sp|Q60YU0|LCMT1_CAEBR Probable leucine carboxyl methyltransferase 1 OS=Caenorhabditis briggsae GN=CBG18087 PE=3 SV=1 22 330 1.0E-33
sp|Q6P4Z6|LCMT1_RAT Leucine carboxyl methyltransferase 1 OS=Rattus norvegicus GN=Lcmt1 PE=2 SV=1 30 332 2.0E-33
sp|Q6FUI5|LCMT1_CANGA Leucine carboxyl methyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPM1 PE=3 SV=1 29 330 3.0E-33
sp|Q04081|LCMT1_YEAST Leucine carboxyl methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPM1 PE=1 SV=1 29 330 3.0E-31
sp|Q3T0H0|LCMT1_BOVIN Leucine carboxyl methyltransferase 1 OS=Bos taurus GN=LCMT1 PE=2 SV=1 30 332 4.0E-31
sp|Q759U5|LCMT1_ASHGO Leucine carboxyl methyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPM1 PE=3 SV=2 29 331 3.0E-29
sp|Q4P4G2|LCMT1_USTMA Leucine carboxyl methyltransferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PPM1 PE=3 SV=2 13 332 6.0E-26
sp|Q75AW4|TYW4_ASHGO tRNA wybutosine-synthesizing protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPM2 PE=3 SV=1 30 342 8.0E-25
sp|Q6C3P4|TYW4_YARLI tRNA wybutosine-synthesizing protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPM2 PE=3 SV=1 29 342 4.0E-24
sp|Q4WVD1|TYW4_ASPFU tRNA wybutosine-synthesizing protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ppm2 PE=3 SV=2 32 331 1.0E-23
sp|Q6CWW0|LCMT1_KLULA Leucine carboxyl methyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPM1 PE=3 SV=1 29 328 3.0E-23
sp|Q2U6D4|TYW4_ASPOR tRNA wybutosine-synthesizing protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ppm2 PE=3 SV=2 32 331 2.0E-22
sp|Q5BH52|TYW4_EMENI tRNA wybutosine-synthesizing protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ppm2 PE=3 SV=3 32 331 3.0E-22
sp|Q6FXA5|TYW4_CANGA tRNA wybutosine-synthesizing protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPM2 PE=3 SV=1 30 333 4.0E-20
sp|O60157|TYW4_SCHPO tRNA wybutosine-synthesizing protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppm2 PE=3 SV=1 30 331 7.0E-20
sp|Q4IER0|TYW4_GIBZE tRNA wybutosine-synthesizing protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PPM2 PE=3 SV=1 14 327 3.0E-19
sp|Q5A931|TYW4_CANAL tRNA wybutosine-synthesizing protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPM2 PE=3 SV=1 30 343 7.0E-17
sp|Q08282|TYW4_YEAST tRNA wybutosine-synthesizing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPM2 PE=1 SV=2 6 332 2.0E-15
sp|Q9P3K9|TYW4_NEUCR tRNA wybutosine-synthesizing protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lcm-2 PE=3 SV=1 30 155 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0032259 methylation Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4016
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7920
Ophiocordyceps australis map64 (Brazil) OphauB2|2734 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03904
Ophiocordyceps camponoti-rufipedis Ophun1|6494
Ophiocordyceps kimflemingae Ophio5|3973
Ophiocordyceps subramaniannii Hirsu2|8069

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2734
MATPLLPNLLAGRSSTRRSRGRRGGGTGLDAVIQDTDNDAAVSRLSAVQMGYLDDGFAEYFVRQPTRRQPIINRG
TYVRTQALDLTIAGFLSHDAGGDKQIVSLGAGTDTRPFRLLGHRSGPRLTYHEIDFEATCRHKLAVVRGTPQLSS
RLRQIDEAASGSWTAQSEHGDAYYCHAADLRALDHGAASVALLASLRTNVPTLVVSECCLCYLTHLEAEGVIDFF
CSRIARLAIVIYEPMPLDDAFGTVMLSNLRARNIVMPSAEHYKNGSGQERRLRHAGFSRVGHMTIDAAWQLLIPT
AEKDRLALLEGLDELEEWTLLAAHYIVAWASRDTSLGHVDQYVVSLAKE*
Coding >OphauB2|2734
ATGGCAACACCTTTGCTCCCCAACCTGCTCGCCGGACGAAGCAGCACTCGACGCAGCCGTGGACGGCGCGGCGGC
GGCACGGGGCTCGATGCCGTGATCCAGGACACGGACAATGATGCGGCCGTGTCGCGGCTGAGCGCGGTGCAGATG
GGCTACCTGGACGATGGCTTTGCCGAGTATTTTGTGCGGCAGCCGACGAGGCGGCAGCCCATCATCAACCGCGGC
ACCTATGTGCGCACACAGGCCCTGGACCTGACAATTGCTGGCTTCCTCTCGCACGACGCGGGCGGCGACAAGCAA
ATCGTATCGCTGGGGGCAGGCACCGACACCAGACCCTTTCGCCTGCTTGGGCACCGTTCGGGTCCGCGACTGACA
TACCACGAAATCGACTTTGAAGCGACGTGCAGACACAAGCTGGCCGTGGTTCGAGGCACGCCACAGTTGAGCAGC
CGGCTGCGTCAGATTGACGAGGCCGCGAGCGGCTCCTGGACGGCGCAGAGCGAGCACGGCGACGCCTACTACTGC
CATGCCGCCGACCTGCGCGCCCTTGACCATGGCGCTGCGTCGGTCGCGCTGCTCGCCTCGCTGCGCACCAATGTG
CCCACGCTCGTTGTGTCCGAGTGCTGCTTGTGCTACCTGACGCACCTCGAGGCTGAAGGCGTCATTGACTTTTTC
TGCTCGCGCATTGCGCGCCTGGCCATTGTCATCTACGAGCCCATGCCCCTCGACGATGCCTTTGGAACCGTGATG
CTGTCCAATTTACGCGCCCGCAACATTGTCATGCCCAGCGCCGAGCACTACAAGAACGGCTCTGGCCAGGAGCGC
CGTCTACGCCACGCCGGCTTCTCCAGAGTTGGCCACATGACAATCGACGCTGCCTGGCAACTCTTGATACCCACA
GCGGAAAAGGACCGTCTGGCGCTGCTCGAGGGGCTCGACGAACTTGAGGAATGGACCCTCTTGGCCGCCCACTAT
ATTGTAGCCTGGGCCTCGAGAGACACCAGTCTTGGCCATGTCGACCAGTACGTGGTGTCTCTGGCCAAGGAGTAG
Transcript >OphauB2|2734
ATGGCAACACCTTTGCTCCCCAACCTGCTCGCCGGACGAAGCAGCACTCGACGCAGCCGTGGACGGCGCGGCGGC
GGCACGGGGCTCGATGCCGTGATCCAGGACACGGACAATGATGCGGCCGTGTCGCGGCTGAGCGCGGTGCAGATG
GGCTACCTGGACGATGGCTTTGCCGAGTATTTTGTGCGGCAGCCGACGAGGCGGCAGCCCATCATCAACCGCGGC
ACCTATGTGCGCACACAGGCCCTGGACCTGACAATTGCTGGCTTCCTCTCGCACGACGCGGGCGGCGACAAGCAA
ATCGTATCGCTGGGGGCAGGCACCGACACCAGACCCTTTCGCCTGCTTGGGCACCGTTCGGGTCCGCGACTGACA
TACCACGAAATCGACTTTGAAGCGACGTGCAGACACAAGCTGGCCGTGGTTCGAGGCACGCCACAGTTGAGCAGC
CGGCTGCGTCAGATTGACGAGGCCGCGAGCGGCTCCTGGACGGCGCAGAGCGAGCACGGCGACGCCTACTACTGC
CATGCCGCCGACCTGCGCGCCCTTGACCATGGCGCTGCGTCGGTCGCGCTGCTCGCCTCGCTGCGCACCAATGTG
CCCACGCTCGTTGTGTCCGAGTGCTGCTTGTGCTACCTGACGCACCTCGAGGCTGAAGGCGTCATTGACTTTTTC
TGCTCGCGCATTGCGCGCCTGGCCATTGTCATCTACGAGCCCATGCCCCTCGACGATGCCTTTGGAACCGTGATG
CTGTCCAATTTACGCGCCCGCAACATTGTCATGCCCAGCGCCGAGCACTACAAGAACGGCTCTGGCCAGGAGCGC
CGTCTACGCCACGCCGGCTTCTCCAGAGTTGGCCACATGACAATCGACGCTGCCTGGCAACTCTTGATACCCACA
GCGGAAAAGGACCGTCTGGCGCTGCTCGAGGGGCTCGACGAACTTGAGGAATGGACCCTCTTGGCCGCCCACTAT
ATTGTAGCCTGGGCCTCGAGAGACACCAGTCTTGGCCATGTCGACCAGTACGTGGTGTCTCTGGCCAAGGAGTAG
Gene >OphauB2|2734
ATGGCAACACCTTTGCTCCCCAACCTGCTCGCCGGACGAAGCAGCACTCGACGCAGCCGTGGACGGCGCGGCGGC
GGCACGGGGCTCGATGCCGTGATCCAGGACACGGACAATGATGCGGCCGTGTCGCGGCTGAGCGCGGTGCAGATG
GGCTACCTGGACGATGGCTTTGCCGAGTATTTTGTGCGGCAGCCGACGAGGCGGCAGCCCATCATCAACCGCGGT
ATGCCTTTAGTTTTTGAAGCCATTTTTACTCGGGGCTTACTTGCTTTTATTACCTGCTTGTCATAAAGGGTCCTG
CTGATAGTAGACTTGTTCGCTCAAGGCACCTATGTGCGCACACAGGCCCTGGACCTGACAATTGCTGGCTTCCTC
TCGCACGACGCGGGCGGCGACAAGCAAATCGTATCGCTGGGGGCAGGCACCGACACCAGACCCTTTCGCCTGCTT
GGGCACCGTTCGGGTCCGCGACTGACATACCACGAAATCGACTTTGAAGCGACGTGCAGACACAAGCTGGCCGTG
GTTCGAGGCACGCCACAGTTGAGCAGCCGGCTGCGTCAGATTGACGAGGCCGCGAGCGGCTCCTGGACGGCGCAG
AGCGAGCACGGCGACGCCTACTACTGCCATGCCGCCGACCTGCGCGCCCTTGACCATGGCGCTGCGTCGGTCGCG
CTGCTCGCCTCGCTGCGCACCAATGTGCCCACGCTCGTTGTGTCCGAGTGCTGCTTGTGCTACCTGACGCACCTC
GAGGCTGAAGGCGTCATTGACTTTTTCTGCTCGCGCATTGCGCGCCTGGCCATTGTCATCTACGAGCCCATGCCC
CTCGACGATGCCTTTGGAACCGTGATGCTGTCCAATTTACGCGCCCGCAACATTGTCATGCCCAGCGCCGAGCAC
TACAAGAACGGCTCTGGCCAGGAGCGCCGTCTACGCCACGCCGGCTTCTCCAGAGTTGGCCACATGACAATCGAC
GCTGCCTGGCAACTCTTGATACCCACAGCGGAAAAGGACCGTCTGGCGCTGCTCGAGGGGCTCGACGAACTTGAG
GAATGGACCCTCTTGGCCGCCCACTATATTGTAGCCTGGGCCTCGAGAGACACCAGTCTTGGCCATGTCGACCAG
TACGTGGTGTCTCTGGCCAAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail