Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2727
Gene name
LocationContig_19:113376..115974
Strand+
Gene length (bp)2598
Transcript length (bp)2481
Coding sequence length (bp)2481
Protein length (aa) 827

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 8.3E-52 49 342
PF14492 EFG_III Elongation Factor G, domain III 3.5E-17 482 556
PF00679 EFG_C Elongation factor G C-terminus 5.2E-07 776 821

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BB57|RRF2M_EMENI Ribosome-releasing factor 2, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mef2 PE=3 SV=1 26 826 0.0E+00
sp|B6Q1T9|RRF2M_TALMQ Ribosome-releasing factor 2, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mef2 PE=3 SV=1 33 826 0.0E+00
sp|B8NDZ1|RRF2M_ASPFN Ribosome-releasing factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef2 PE=3 SV=1 24 826 0.0E+00
sp|A2R994|RRF2M_ASPNC Ribosome-releasing factor 2, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef2 PE=3 SV=1 30 826 0.0E+00
sp|B8MR69|RRF2M_TALSN Ribosome-releasing factor 2, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef2 PE=3 SV=2 48 826 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BB57|RRF2M_EMENI Ribosome-releasing factor 2, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mef2 PE=3 SV=1 26 826 0.0E+00
sp|B6Q1T9|RRF2M_TALMQ Ribosome-releasing factor 2, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mef2 PE=3 SV=1 33 826 0.0E+00
sp|B8NDZ1|RRF2M_ASPFN Ribosome-releasing factor 2, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mef2 PE=3 SV=1 24 826 0.0E+00
sp|A2R994|RRF2M_ASPNC Ribosome-releasing factor 2, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mef2 PE=3 SV=1 30 826 0.0E+00
sp|B8MR69|RRF2M_TALSN Ribosome-releasing factor 2, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mef2 PE=3 SV=2 48 826 0.0E+00
sp|Q6CBI0|RRF2M_YARLI Ribosome-releasing factor 2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MEF2 PE=3 SV=1 43 818 1.0E-128
sp|B5RUN4|RRF2M_DEBHA Ribosome-releasing factor 2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MEF2 PE=3 SV=1 52 822 2.0E-127
sp|Q5AAV3|RRF2M_CANAL Ribosome-releasing factor 2, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEF2 PE=3 SV=1 52 822 1.0E-126
sp|B9W892|RRF2M_CANDC Ribosome-releasing factor 2, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MEF2 PE=3 SV=1 52 822 4.0E-126
sp|A5DTX8|RRF2M_LODEL Ribosome-releasing factor 2, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MEF2 PE=3 SV=1 45 822 5.0E-126
sp|A5DB27|RRF2M_PICGU Ribosome-releasing factor 2, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MEF2 PE=3 SV=2 50 819 1.0E-125
sp|A3LWR2|RRF2M_PICST Ribosome-releasing factor 2, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MEF2 PE=3 SV=2 48 822 8.0E-124
sp|A6ZQM4|RRF2M_YEAS7 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MEF2 PE=3 SV=1 48 822 6.0E-120
sp|P39677|RRF2M_YEAST Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEF2 PE=1 SV=1 48 822 3.0E-119
sp|B3LQ11|RRF2M_YEAS1 Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MEF2 PE=3 SV=1 48 822 3.0E-119
sp|Q754I9|RRF2M_ASHGO Ribosome-releasing factor 2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEF2 PE=3 SV=1 42 826 5.0E-119
sp|O94429|RRF2M_SCHPO Ribosome-releasing factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mef2 PE=3 SV=1 47 811 2.0E-118
sp|A7TQJ9|RRF2M_VANPO Ribosome-releasing factor 2, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MEF2 PE=3 SV=1 48 822 3.0E-116
sp|Q6FLG2|RRF2M_CANGA Ribosome-releasing factor 2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEF2 PE=3 SV=1 38 822 4.0E-116
sp|A5FV42|EFG_ACICJ Elongation factor G OS=Acidiphilium cryptum (strain JF-5) GN=fusA PE=3 SV=1 47 815 7.0E-115
sp|Q6CK29|RRF2M_KLULA Ribosome-releasing factor 2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEF2 PE=3 SV=1 48 822 7.0E-115
sp|Q134S6|EFG_RHOPS Elongation factor G OS=Rhodopseudomonas palustris (strain BisB5) GN=fusA PE=3 SV=1 46 816 2.0E-114
sp|B3QBY3|EFG_RHOPT Elongation factor G OS=Rhodopseudomonas palustris (strain TIE-1) GN=fusA PE=3 SV=1 46 816 6.0E-114
sp|Q6N4T4|EFG_RHOPA Elongation factor G OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fusA PE=3 SV=1 46 816 6.0E-114
sp|Q1QN33|EFG_NITHX Elongation factor G OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=fusA PE=3 SV=1 46 816 2.0E-113
sp|Q89J81|EFG_BRADU Elongation factor G OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fusA PE=3 SV=1 46 816 4.0E-113
sp|Q07KL5|EFG_RHOP5 Elongation factor G OS=Rhodopseudomonas palustris (strain BisA53) GN=fusA PE=3 SV=1 46 816 1.0E-112
sp|Q0BSG5|EFG_GRABC Elongation factor G OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fusA PE=3 SV=1 47 815 2.0E-112
sp|Q3SSW9|EFG_NITWN Elongation factor G OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=fusA PE=3 SV=1 46 816 3.0E-111
sp|A6Q1M7|EFG_NITSB Elongation factor G OS=Nitratiruptor sp. (strain SB155-2) GN=fusA PE=3 SV=1 48 818 3.0E-111
sp|A5ELN0|EFG_BRASB Elongation factor G OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fusA PE=3 SV=1 46 816 4.0E-111
sp|Q2IXR3|EFG_RHOP2 Elongation factor G OS=Rhodopseudomonas palustris (strain HaA2) GN=fusA PE=3 SV=1 46 816 1.0E-110
sp|B8IS82|EFG_METNO Elongation factor G OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fusA PE=3 SV=1 46 818 4.0E-110
sp|B1ZLK1|EFG_METPB Elongation factor G OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=fusA PE=3 SV=1 46 818 4.0E-110
sp|Q6MJ13|EFG1_BDEBA Elongation factor G 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=fusA1 PE=3 SV=1 48 818 8.0E-110
sp|A7IFX8|EFG_XANP2 Elongation factor G OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=fusA PE=3 SV=1 46 818 9.0E-110
sp|B0UHX2|EFG_METS4 Elongation factor G OS=Methylobacterium sp. (strain 4-46) GN=fusA PE=3 SV=1 46 818 1.0E-109
sp|Q7MA53|EFG_WOLSU Elongation factor G OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=fusA PE=3 SV=1 48 824 1.0E-109
sp|B6JET0|EFG_OLICO Elongation factor G OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=fusA PE=3 SV=1 48 816 2.0E-109
sp|B1LWS3|EFG_METRJ Elongation factor G OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=fusA PE=3 SV=1 46 818 5.0E-109
sp|Q211E5|EFG_RHOPB Elongation factor G OS=Rhodopseudomonas palustris (strain BisB18) GN=fusA PE=3 SV=1 46 816 7.0E-109
sp|Q8KTB0|EFG_RICBE Elongation factor G OS=Rickettsia bellii GN=fusA PE=3 SV=1 48 818 1.0E-108
sp|A8GV17|EFG_RICB8 Elongation factor G OS=Rickettsia bellii (strain OSU 85-389) GN=fusA PE=3 SV=1 48 818 1.0E-108
sp|A8IAT3|EFG_AZOC5 Elongation factor G OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=fusA PE=3 SV=1 46 818 2.0E-108
sp|A8Z6I6|EFG_CAMC1 Elongation factor G OS=Campylobacter concisus (strain 13826) GN=fusA PE=3 SV=1 48 818 8.0E-108
sp|Q1RHC3|EFG_RICBR Elongation factor G OS=Rickettsia bellii (strain RML369-C) GN=fusA PE=3 SV=1 48 818 9.0E-108
sp|B9K883|EFG_THENN Elongation factor G OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fusA PE=3 SV=1 48 818 1.0E-107
sp|Q1GBM0|EFG_LACDA Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=fusA PE=3 SV=1 47 816 1.0E-107
sp|A9W4P8|EFG_METEP Elongation factor G OS=Methylobacterium extorquens (strain PA1) GN=fusA PE=3 SV=1 46 818 1.0E-107
sp|B7L0Q8|EFG_METC4 Elongation factor G OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=fusA PE=3 SV=1 46 818 1.0E-107
sp|Q04C17|EFG_LACDB Elongation factor G OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fusA PE=3 SV=1 47 816 2.0E-107
sp|A7GZJ4|EFG_CAMC5 Elongation factor G OS=Campylobacter curvus (strain 525.92) GN=fusA PE=3 SV=1 48 818 2.0E-107
sp|Q8DI43|EFG_THEEB Elongation factor G OS=Thermosynechococcus elongatus (strain BP-1) GN=fusA PE=3 SV=1 48 818 3.0E-107
sp|Q5FUP6|EFG_GLUOX Elongation factor G OS=Gluconobacter oxydans (strain 621H) GN=fusA PE=3 SV=1 46 815 3.0E-107
sp|Q82DQ1|EFG_STRAW Elongation factor G OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fusA PE=3 SV=1 48 818 5.0E-107
sp|Q3BWY7|EFG_XANC5 Elongation factor G OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fusA PE=3 SV=1 48 815 6.0E-107
sp|Q74L90|EFG_LACJO Elongation factor G OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=fusA PE=3 SV=1 48 816 6.0E-107
sp|Q8PNS6|EFG_XANAC Elongation factor G OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fusA PE=3 SV=1 48 815 6.0E-107
sp|P40173|EFG1_STRCO Elongation factor G 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fusA PE=3 SV=2 48 818 7.0E-107
sp|P13551|EFG_THETH Elongation factor G OS=Thermus thermophilus GN=fusA PE=1 SV=1 39 818 1.0E-106
sp|Q5SHN5|EFG_THET8 Elongation factor G OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=fusA PE=1 SV=1 39 818 1.0E-106
sp|B1W417|EFG_STRGG Elongation factor G OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=fusA PE=3 SV=1 48 818 1.0E-106
sp|Q1R0H8|EFG_CHRSD Elongation factor G OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fusA PE=3 SV=1 48 815 1.0E-106
sp|A6LLL0|EFG_THEM4 Elongation factor G OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=fusA PE=3 SV=1 48 818 1.0E-106
sp|Q72I01|EFG_THET2 Elongation factor G OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fusA PE=1 SV=1 39 818 2.0E-106
sp|P18667|EFG_SYNP6 Elongation factor G OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fusA PE=3 SV=1 48 818 2.0E-106
sp|Q31PV4|EFG_SYNE7 Elongation factor G OS=Synechococcus elongatus (strain PCC 7942) GN=fusA PE=3 SV=1 48 818 2.0E-106
sp|Q17VN9|EFG_HELAH Elongation factor G OS=Helicobacter acinonychis (strain Sheeba) GN=fusA PE=3 SV=1 48 818 3.0E-106
sp|C3PKP1|EFG_CORA7 Elongation factor G OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=fusA PE=3 SV=1 48 818 3.0E-106
sp|Q8KTA8|EFG_RICFE Elongation factor G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fusA PE=3 SV=2 46 818 4.0E-106
sp|A5V605|EFG_SPHWW Elongation factor G OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=fusA PE=3 SV=1 48 818 5.0E-106
sp|Q2W2I8|EFG_MAGSA Elongation factor G OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fusA PE=3 SV=1 48 818 6.0E-106
sp|Q5GWS9|EFG_XANOR Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fusA PE=3 SV=2 48 815 6.0E-106
sp|Q2NZY2|EFG_XANOM Elongation factor G OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fusA PE=3 SV=1 48 815 6.0E-106
sp|Q83NA0|EFG_TROW8 Elongation factor G OS=Tropheryma whipplei (strain TW08/27) GN=fusA PE=3 SV=1 48 816 7.0E-106
sp|Q1BDD4|EFG_MYCSS Elongation factor G OS=Mycobacterium sp. (strain MCS) GN=fusA PE=3 SV=1 48 818 7.0E-106
sp|A1UBL0|EFG_MYCSK Elongation factor G OS=Mycobacterium sp. (strain KMS) GN=fusA PE=3 SV=1 48 818 7.0E-106
sp|A3PV95|EFG_MYCSJ Elongation factor G OS=Mycobacterium sp. (strain JLS) GN=fusA PE=3 SV=1 48 818 7.0E-106
sp|B1I1I5|EFG_DESAP Elongation factor G OS=Desulforudis audaxviator (strain MP104C) GN=fusA PE=3 SV=1 48 818 8.0E-106
sp|Q9ZK24|EFG_HELPJ Elongation factor G OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fusA PE=3 SV=3 48 818 8.0E-106
sp|P56002|EFG_HELPY Elongation factor G OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fusA PE=3 SV=2 48 818 8.0E-106
sp|B9KFH1|EFG_CAMLR Elongation factor G OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=fusA PE=3 SV=1 48 818 1.0E-105
sp|Q83FP1|EFG_TROWT Elongation factor G OS=Tropheryma whipplei (strain Twist) GN=fusA PE=3 SV=1 48 816 1.0E-105
sp|A6Q6I6|EFG_SULNB Elongation factor G OS=Sulfurovum sp. (strain NBC37-1) GN=fusA PE=3 SV=1 46 818 1.0E-105
sp|Q1CS71|EFG_HELPH Elongation factor G OS=Helicobacter pylori (strain HPAG1) GN=fusA PE=3 SV=1 48 818 1.0E-105
sp|B5ELX6|EFG_ACIF5 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=fusA PE=3 SV=1 48 821 1.0E-105
sp|B7J464|EFG_ACIF2 Elongation factor G OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=fusA PE=3 SV=1 48 821 1.0E-105
sp|Q47LJ0|EFG_THEFY Elongation factor G OS=Thermobifida fusca (strain YX) GN=fusA PE=3 SV=1 48 818 2.0E-105
sp|Q8KTB4|EFG_RICHE Elongation factor G OS=Rickettsia helvetica GN=fusA PE=3 SV=1 46 818 2.0E-105
sp|A5D5I7|EFG_PELTS Elongation factor G OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=fusA PE=3 SV=1 48 826 2.0E-105
sp|B6JN34|EFG_HELP2 Elongation factor G OS=Helicobacter pylori (strain P12) GN=fusA PE=3 SV=1 48 818 2.0E-105
sp|C0ZVT6|EFG_RHOE4 Elongation factor G OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=fusA PE=3 SV=1 48 818 2.0E-105
sp|B8DTV6|EFG_BIFA0 Elongation factor G OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=fusA PE=3 SV=1 47 818 2.0E-105
sp|Q5YPG3|EFG_NOCFA Elongation factor G OS=Nocardia farcinica (strain IFM 10152) GN=fusA PE=3 SV=1 48 818 2.0E-105
sp|C1AYS4|EFG_RHOOB Elongation factor G OS=Rhodococcus opacus (strain B4) GN=fusA PE=3 SV=1 48 818 2.0E-105
sp|B5Z8J0|EFG_HELPG Elongation factor G OS=Helicobacter pylori (strain G27) GN=fusA PE=3 SV=1 48 818 3.0E-105
sp|C3PMH0|EFG_RICAE Elongation factor G OS=Rickettsia africae (strain ESF-5) GN=fusA PE=3 SV=1 46 818 3.0E-105
sp|B2UUV6|EFG_HELPS Elongation factor G OS=Helicobacter pylori (strain Shi470) GN=fusA PE=3 SV=1 48 818 3.0E-105
sp|Q8KTB6|EFG_RICMO Elongation factor G OS=Rickettsia montanensis GN=fusA PE=3 SV=1 46 818 4.0E-105
sp|A4T1R3|EFG_MYCGI Elongation factor G OS=Mycobacterium gilvum (strain PYR-GCK) GN=fusA PE=3 SV=1 48 818 5.0E-105
sp|A9BHA8|EFG_PETMO Elongation factor G OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=fusA PE=3 SV=1 48 818 6.0E-105
sp|B1VET0|EFG_CORU7 Elongation factor G OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=fusA PE=3 SV=1 48 818 6.0E-105
sp|Q0SFF3|EFG_RHOJR Elongation factor G OS=Rhodococcus jostii (strain RHA1) GN=fusA PE=3 SV=1 48 818 9.0E-105
sp|A8F0P0|EFG_RICM5 Elongation factor G OS=Rickettsia massiliae (strain Mtu5) GN=fusA PE=3 SV=2 46 818 9.0E-105
sp|A6W5T4|EFG_KINRD Elongation factor G OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=fusA PE=3 SV=1 48 818 9.0E-105
sp|C4K4F9|EFG_HAMD5 Elongation factor G OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=fusA PE=3 SV=1 48 816 9.0E-105
sp|A8GMA0|EFG_RICAH Elongation factor G OS=Rickettsia akari (strain Hartford) GN=fusA PE=3 SV=1 46 818 1.0E-104
sp|Q92J93|EFG_RICCN Elongation factor G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fusA PE=3 SV=1 46 818 1.0E-104
sp|A1SNN6|EFG_NOCSJ Elongation factor G OS=Nocardioides sp. (strain BAA-499 / JS614) GN=fusA PE=3 SV=1 48 818 1.0E-104
sp|Q605A9|EFG2_METCA Elongation factor G 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=fusA2 PE=3 SV=1 48 821 2.0E-104
sp|Q8KTB8|EFG_RICSI Elongation factor G OS=Rickettsia sibirica GN=fusA PE=3 SV=1 46 818 2.0E-104
sp|A8M532|EFG_SALAI Elongation factor G OS=Salinispora arenicola (strain CNS-205) GN=fusA PE=3 SV=1 46 818 2.0E-104
sp|Q046C7|EFG_LACGA Elongation factor G OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=fusA PE=3 SV=1 48 816 2.0E-104
sp|Q8KTC1|EFG_RICRI Elongation factor G OS=Rickettsia rickettsii GN=fusA PE=3 SV=1 46 818 2.0E-104
sp|A8GQV7|EFG_RICRS Elongation factor G OS=Rickettsia rickettsii (strain Sheila Smith) GN=fusA PE=3 SV=1 46 818 2.0E-104
sp|B0BWA2|EFG_RICRO Elongation factor G OS=Rickettsia rickettsii (strain Iowa) GN=fusA PE=3 SV=1 46 818 2.0E-104
sp|Q0RRS4|EFG_FRAAA Elongation factor G OS=Frankia alni (strain ACN14a) GN=fusA PE=3 SV=1 46 824 2.0E-104
sp|Q4FQG5|EFG_PSYA2 Elongation factor G OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fusA PE=3 SV=1 48 818 2.0E-104
sp|C4K1P6|EFG_RICPU Elongation factor G OS=Rickettsia peacockii (strain Rustic) GN=fusA PE=3 SV=1 46 818 2.0E-104
sp|B7GJ64|EFG_ANOFW Elongation factor G OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=fusA PE=3 SV=1 47 818 3.0E-104
sp|A7I3T6|EFG_CAMHC Elongation factor G OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=fusA PE=3 SV=1 48 818 3.0E-104
sp|Q2RFP4|EFG_MOOTA Elongation factor G OS=Moorella thermoacetica (strain ATCC 39073) GN=fusA PE=3 SV=1 48 818 3.0E-104
sp|Q88XY8|EFG_LACPL Elongation factor G OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fusA PE=3 SV=1 47 818 3.0E-104
sp|A1VYJ8|EFG_CAMJJ Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=fusA PE=3 SV=1 48 818 3.0E-104
sp|B2IK59|EFG_BEII9 Elongation factor G OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=fusA PE=3 SV=1 48 818 4.0E-104
sp|Q1Q8P1|EFG_PSYCK Elongation factor G OS=Psychrobacter cryohalolentis (strain K5) GN=fusA PE=3 SV=1 48 818 4.0E-104
sp|B1HMZ1|EFG_LYSSC Elongation factor G OS=Lysinibacillus sphaericus (strain C3-41) GN=fusA PE=3 SV=1 47 818 5.0E-104
sp|Q03ZQ2|EFG_LEUMM Elongation factor G OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=fusA PE=3 SV=1 40 818 5.0E-104
sp|Q8KTB9|EFG_RICPA Elongation factor G OS=Rickettsia parkeri GN=fusA PE=3 SV=1 46 818 5.0E-104
sp|A8YXK3|EFG_LACH4 Elongation factor G OS=Lactobacillus helveticus (strain DPC 4571) GN=fusA PE=3 SV=1 48 816 5.0E-104
sp|P41084|EFG_RICPR Elongation factor G OS=Rickettsia prowazekii (strain Madrid E) GN=fusA PE=3 SV=3 46 818 5.0E-104
sp|Q1WVA0|EFG_LACS1 Elongation factor G OS=Lactobacillus salivarius (strain UCC118) GN=fusA PE=3 SV=1 48 818 5.0E-104
sp|Q5L400|EFG_GEOKA Elongation factor G OS=Geobacillus kaustophilus (strain HTA426) GN=fusA PE=3 SV=1 47 818 6.0E-104
sp|B3CTE7|EFG_ORITI Elongation factor G OS=Orientia tsutsugamushi (strain Ikeda) GN=fusA PE=3 SV=1 43 818 7.0E-104
sp|C1A6Q2|EFG_GEMAT Elongation factor G OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=fusA PE=3 SV=1 48 818 9.0E-104
sp|Q39Y09|EFG1_GEOMG Elongation factor G 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fusA1 PE=3 SV=1 48 818 1.0E-103
sp|B1MW21|EFG_LEUCK Elongation factor G OS=Leuconostoc citreum (strain KM20) GN=fusA PE=3 SV=1 40 818 1.0E-103
sp|Q03IS1|EFG_STRTD Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=fusA PE=3 SV=1 47 818 1.0E-103
sp|Q5M2M6|EFG_STRT2 Elongation factor G OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fusA PE=3 SV=1 47 818 1.0E-103
sp|Q5LY21|EFG_STRT1 Elongation factor G OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fusA PE=3 SV=1 47 818 1.0E-103
sp|Q748Y8|EFG2_GEOSL Elongation factor G 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=fusA2 PE=3 SV=1 47 818 1.0E-103
sp|B3QR64|EFG_CHLP8 Elongation factor G OS=Chlorobaculum parvum (strain NCIB 8327) GN=fusA PE=3 SV=1 47 818 1.0E-103
sp|Q3MDM4|EFG_ANAVT Elongation factor G OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fusA PE=3 SV=1 46 818 1.0E-103
sp|Q8G5B6|EFG_BIFLO Elongation factor G OS=Bifidobacterium longum (strain NCC 2705) GN=fusA PE=3 SV=1 46 818 1.0E-103
sp|B3DT30|EFG_BIFLD Elongation factor G OS=Bifidobacterium longum (strain DJO10A) GN=fusA PE=3 SV=1 46 818 1.0E-103
sp|B8ELG6|EFG_METSB Elongation factor G OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=fusA PE=3 SV=1 46 818 2.0E-103
sp|A9VP74|EFG_BACWK Elongation factor G OS=Bacillus weihenstephanensis (strain KBAB4) GN=fusA PE=3 SV=1 47 818 2.0E-103
sp|Q5ZYP6|EFG_LEGPH Elongation factor G OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fusA PE=3 SV=1 48 816 2.0E-103
sp|A7HWQ8|EFG_PARL1 Elongation factor G OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fusA PE=3 SV=1 46 818 2.0E-103
sp|Q63H93|EFG_BACCZ Elongation factor G OS=Bacillus cereus (strain ZK / E33L) GN=fusA PE=3 SV=1 47 818 2.0E-103
sp|Q04ED6|EFG_OENOB Elongation factor G OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=fusA PE=3 SV=1 48 818 3.0E-103
sp|Q8FS85|EFG_COREF Elongation factor G OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fusA PE=3 SV=2 48 818 3.0E-103
sp|Q5FM92|EFG_LACAC Elongation factor G OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fusA PE=3 SV=1 48 816 3.0E-103
sp|Q5WZL5|EFG_LEGPL Elongation factor G OS=Legionella pneumophila (strain Lens) GN=fusA PE=3 SV=1 48 816 3.0E-103
sp|A5IHR7|EFG_LEGPC Elongation factor G OS=Legionella pneumophila (strain Corby) GN=fusA PE=3 SV=1 48 816 3.0E-103
sp|Q6NJD6|EFG_CORDI Elongation factor G OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=fusA PE=3 SV=2 48 818 3.0E-103
sp|Q8KTB7|EFG_RICRH Elongation factor G OS=Rickettsia rhipicephali GN=fusA PE=3 SV=1 46 818 3.0E-103
sp|Q5X862|EFG_LEGPA Elongation factor G OS=Legionella pneumophila (strain Paris) GN=fusA PE=3 SV=1 48 816 4.0E-103
sp|A1A0T0|EFG_BIFAA Elongation factor G OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=fusA PE=3 SV=1 46 818 4.0E-103
sp|A0RQI0|EFG_CAMFF Elongation factor G OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=fusA PE=3 SV=1 48 818 4.0E-103
sp|C5C0J4|EFG_BEUC1 Elongation factor G OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=fusA PE=3 SV=1 46 818 4.0E-103
sp|Q7NAV3|EFG_MYCGA Elongation factor G OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=fusA PE=3 SV=2 48 816 4.0E-103
sp|B9IZJ1|EFG_BACCQ Elongation factor G OS=Bacillus cereus (strain Q1) GN=fusA PE=3 SV=1 47 818 5.0E-103
sp|B7HQU1|EFG_BACC7 Elongation factor G OS=Bacillus cereus (strain AH187) GN=fusA PE=3 SV=1 47 818 5.0E-103
sp|C3LJ79|EFG_BACAC Elongation factor G OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fusA PE=3 SV=1 47 818 5.0E-103
sp|Q492B1|EFG_BLOPB Elongation factor G OS=Blochmannia pennsylvanicus (strain BPEN) GN=fusA PE=3 SV=1 52 818 5.0E-103
sp|A2RP72|EFG_LACLM Elongation factor G OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fusA PE=3 SV=1 47 818 5.0E-103
sp|Q1AU26|EFG_RUBXD Elongation factor G OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fusA PE=3 SV=1 39 818 5.0E-103
sp|Q8KAG9|EFG_CHLTE Elongation factor G OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=fusA-1 PE=3 SV=1 47 818 5.0E-103
sp|Q2GJ60|EFG_ANAPZ Elongation factor G OS=Anaplasma phagocytophilum (strain HZ) GN=fusA PE=3 SV=1 43 818 5.0E-103
sp|Q8YP62|EFG_NOSS1 Elongation factor G OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fusA PE=3 SV=1 46 818 6.0E-103
sp|Q6HPR1|EFG_BACHK Elongation factor G OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fusA PE=3 SV=1 47 818 6.0E-103
sp|C1ET36|EFG_BACC3 Elongation factor G OS=Bacillus cereus (strain 03BB102) GN=fusA PE=3 SV=1 47 818 6.0E-103
sp|Q81VT3|EFG_BACAN Elongation factor G OS=Bacillus anthracis GN=fusA PE=3 SV=1 47 818 6.0E-103
sp|C3P9Q2|EFG_BACAA Elongation factor G OS=Bacillus anthracis (strain A0248) GN=fusA PE=3 SV=1 47 818 6.0E-103
sp|Q2K9L9|EFG_RHIEC Elongation factor G OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fusA PE=3 SV=1 42 818 6.0E-103
sp|A4FPM8|EFG_SACEN Elongation factor G OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=fusA PE=3 SV=1 42 818 6.0E-103
sp|Q5HVX6|EFG_CAMJR Elongation factor G OS=Campylobacter jejuni (strain RM1221) GN=fusA PE=3 SV=1 48 818 7.0E-103
sp|Q9PI16|EFG_CAMJE Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fusA PE=3 SV=1 48 818 7.0E-103
sp|A8FKR7|EFG_CAMJ8 Elongation factor G OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=fusA PE=3 SV=1 48 818 7.0E-103
sp|Q01W89|EFG_SOLUE Elongation factor G OS=Solibacter usitatus (strain Ellin6076) GN=fusA PE=3 SV=1 48 818 7.0E-103
sp|Q3YSU3|EFG_EHRCJ Elongation factor G OS=Ehrlichia canis (strain Jake) GN=fusA PE=3 SV=1 45 818 7.0E-103
sp|Q6AP74|EFG2_DESPS Elongation factor G 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fusA2 PE=3 SV=1 47 815 7.0E-103
sp|Q814C5|EFG_BACCR Elongation factor G OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fusA PE=3 SV=1 47 818 7.0E-103
sp|B7HJ45|EFG_BACC4 Elongation factor G OS=Bacillus cereus (strain B4264) GN=fusA PE=3 SV=1 47 818 7.0E-103
sp|C0MF25|EFG_STRS7 Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fusA PE=3 SV=1 47 818 7.0E-103
sp|C0M937|EFG_STRE4 Elongation factor G OS=Streptococcus equi subsp. equi (strain 4047) GN=fusA PE=3 SV=1 47 818 7.0E-103
sp|P74228|EFG2_SYNY3 Elongation factor G 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fusB PE=3 SV=1 48 818 8.0E-103
sp|Q9CDG1|EFG_LACLA Elongation factor G OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fusA PE=3 SV=1 47 818 8.0E-103
sp|A4VSN3|EFG_STRSY Elongation factor G OS=Streptococcus suis (strain 05ZYH33) GN=fusA PE=3 SV=1 47 818 9.0E-103
sp|A4VYX6|EFG_STRS2 Elongation factor G OS=Streptococcus suis (strain 98HAH33) GN=fusA PE=3 SV=1 47 818 9.0E-103
sp|C1F645|EFG_ACIC5 Elongation factor G OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=fusA PE=3 SV=1 48 815 9.0E-103
sp|Q8DVV4|EFG_STRMU Elongation factor G OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fusA PE=3 SV=1 47 818 9.0E-103
sp|A8AUR6|EFG_STRGC Elongation factor G OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=fusA PE=3 SV=1 47 818 9.0E-103
sp|A7H4P5|EFG_CAMJD Elongation factor G OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=fusA PE=3 SV=1 48 818 1.0E-102
sp|C1CIF3|EFG_STRZP Elongation factor G OS=Streptococcus pneumoniae (strain P1031) GN=fusA PE=3 SV=1 47 818 1.0E-102
sp|Q2JUX5|EFG_SYNJA Elongation factor G OS=Synechococcus sp. (strain JA-3-3Ab) GN=fusA PE=3 SV=1 48 818 1.0E-102
sp|Q4JT40|EFG_CORJK Elongation factor G OS=Corynebacterium jeikeium (strain K411) GN=fusA PE=3 SV=1 48 818 1.0E-102
sp|A4XBP9|EFG_SALTO Elongation factor G OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=fusA PE=3 SV=1 46 818 1.0E-102
sp|B2G8Y0|EFG_LACRJ Elongation factor G OS=Lactobacillus reuteri (strain JCM 1112) GN=fusA PE=3 SV=1 39 818 1.0E-102
sp|A5VLK8|EFG_LACRD Elongation factor G OS=Lactobacillus reuteri (strain DSM 20016) GN=fusA PE=3 SV=1 39 818 1.0E-102
sp|A8EXK1|EFG_RICCK Elongation factor G OS=Rickettsia canadensis (strain McKiel) GN=fusA PE=3 SV=1 46 818 1.0E-102
sp|Q3A6Q0|EFG2_PELCD Elongation factor G 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=fusA2 PE=3 SV=1 47 818 1.0E-102
sp|B3PWR8|EFG_RHIE6 Elongation factor G OS=Rhizobium etli (strain CIAT 652) GN=fusA PE=3 SV=1 42 818 2.0E-102
sp|B7IT16|EFG_BACC2 Elongation factor G OS=Bacillus cereus (strain G9842) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|B5XJR1|EFG_STRPZ Elongation factor G OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|Q8PC52|EFG_XANCP Elongation factor G OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fusA PE=3 SV=1 48 815 2.0E-102
sp|B0RU85|EFG_XANCB Elongation factor G OS=Xanthomonas campestris pv. campestris (strain B100) GN=fusA PE=3 SV=1 48 815 2.0E-102
sp|Q4URD6|EFG_XANC8 Elongation factor G OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fusA PE=3 SV=1 48 815 2.0E-102
sp|B8ZKU0|EFG_STRPJ Elongation factor G OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|P38525|EFG_THEMA Elongation factor G OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fusA PE=3 SV=2 48 818 2.0E-102
sp|A5CF23|EFG_ORITB Elongation factor G OS=Orientia tsutsugamushi (strain Boryong) GN=fusA PE=3 SV=1 43 818 2.0E-102
sp|Q73F99|EFG_BACC1 Elongation factor G OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|B7IHU3|EFG_THEAB Elongation factor G OS=Thermosipho africanus (strain TCF52B) GN=fusA PE=3 SV=1 48 818 2.0E-102
sp|Q8R7V1|EFG_CALS4 Elongation factor G OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fusA PE=3 SV=1 45 818 2.0E-102
sp|B1I8Z9|EFG_STRPI Elongation factor G OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|C1CC62|EFG_STRZJ Elongation factor G OS=Streptococcus pneumoniae (strain JJA) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|C1CPE5|EFG_STRZT Elongation factor G OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|B2ISJ9|EFG_STRPS Elongation factor G OS=Streptococcus pneumoniae (strain CGSP14) GN=fusA PE=3 SV=1 47 818 2.0E-102
sp|B4U0V9|EFG_STREM Elongation factor G OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=fusA PE=3 SV=1 47 818 3.0E-102
sp|C5D3R4|EFG_GEOSW Elongation factor G OS=Geobacillus sp. (strain WCH70) GN=fusA PE=3 SV=1 47 818 3.0E-102
sp|C5CC67|EFG_MICLC Elongation factor G OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=fusA PE=3 SV=1 48 818 3.0E-102
sp|A5IM80|EFG_THEP1 Elongation factor G OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fusA PE=3 SV=1 48 818 3.0E-102
sp|Q2JMX8|EFG_SYNJB Elongation factor G OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fusA PE=3 SV=1 48 818 3.0E-102
sp|Q82T70|EFG_NITEU Elongation factor G OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fusA PE=3 SV=1 48 816 4.0E-102
sp|Q05FI2|EFG_CARRP Elongation factor G OS=Carsonella ruddii (strain PV) GN=fusA PE=3 SV=1 46 816 4.0E-102
sp|A4SCQ6|EFG_CHLPM Elongation factor G OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=fusA PE=3 SV=1 47 818 4.0E-102
sp|Q7U4D2|EFG_SYNPX Elongation factor G OS=Synechococcus sp. (strain WH8102) GN=fusA PE=3 SV=1 45 818 4.0E-102
sp|Q5PBH2|EFG_ANAMM Elongation factor G OS=Anaplasma marginale (strain St. Maries) GN=fusA PE=3 SV=1 43 818 5.0E-102
sp|P0DA85|EFG_STRPQ Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fus PE=3 SV=1 47 818 5.0E-102
sp|Q48VB6|EFG_STRPM Elongation factor G OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fusA PE=3 SV=1 47 818 5.0E-102
sp|Q1J8I4|EFG_STRPF Elongation factor G OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fusA PE=3 SV=1 47 818 5.0E-102
sp|Q1JIM6|EFG_STRPD Elongation factor G OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fusA PE=3 SV=1 47 818 5.0E-102
sp|Q1JNH7|EFG_STRPC Elongation factor G OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fusA PE=3 SV=1 47 818 5.0E-102
sp|P69948|EFG_STRP8 Elongation factor G OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fus PE=3 SV=2 47 818 5.0E-102
sp|Q5XDW4|EFG_STRP6 Elongation factor G OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fus PE=1 SV=3 47 818 5.0E-102
sp|P0DA84|EFG_STRP3 Elongation factor G OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fus PE=3 SV=1 47 818 5.0E-102
sp|P69946|EFG_STRP1 Elongation factor G OS=Streptococcus pyogenes serotype M1 GN=fus PE=3 SV=2 47 818 5.0E-102
sp|Q9Z9L7|EFG_BACHD Elongation factor G OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fusA PE=3 SV=2 47 818 5.0E-102
sp|Q1GP96|EFG_SPHAL Elongation factor G OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=fusA PE=3 SV=1 48 818 6.0E-102
sp|A8EW86|EFG_ARCB4 Elongation factor G OS=Arcobacter butzleri (strain RM4018) GN=fusA PE=3 SV=1 48 818 6.0E-102
sp|B2GDX1|EFG_LACF3 Elongation factor G OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=fusA PE=3 SV=1 39 818 7.0E-102
sp|B9KHV3|EFG_ANAMF Elongation factor G OS=Anaplasma marginale (strain Florida) GN=fusA PE=3 SV=1 43 818 7.0E-102
sp|B1LBP3|EFG_THESQ Elongation factor G OS=Thermotoga sp. (strain RQ2) GN=fusA PE=3 SV=1 48 818 8.0E-102
sp|P64023|EFG_STRR6 Elongation factor G OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fusA PE=3 SV=1 47 818 8.0E-102
sp|P64022|EFG_STRPN Elongation factor G OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fusA PE=3 SV=1 47 818 8.0E-102
sp|C1CB46|EFG_STRP7 Elongation factor G OS=Streptococcus pneumoniae (strain 70585) GN=fusA PE=3 SV=1 47 818 8.0E-102
sp|B5E6U5|EFG_STRP4 Elongation factor G OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fusA PE=3 SV=1 47 818 8.0E-102
sp|Q04MH7|EFG_STRP2 Elongation factor G OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fusA PE=3 SV=1 47 818 8.0E-102
sp|Q2GFN5|EFG_EHRCR Elongation factor G OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=fusA PE=3 SV=1 43 818 8.0E-102
sp|B7JKB6|EFG_BACC0 Elongation factor G OS=Bacillus cereus (strain AH820) GN=fusA PE=3 SV=1 47 818 8.0E-102
sp|B9MB70|EFG_ACIET Elongation factor G OS=Acidovorax ebreus (strain TPSY) GN=fusA PE=3 SV=1 48 816 8.0E-102
sp|Q8KTB2|EFG_RICTY Elongation factor G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fusA PE=3 SV=2 46 818 8.0E-102
sp|Q8EX19|EFG_MYCPE Elongation factor G OS=Mycoplasma penetrans (strain HF-2) GN=fusA PE=3 SV=1 42 817 9.0E-102
sp|Q0SMG2|EFG2_BORAP Elongation factor G 2 OS=Borrelia afzelii (strain PKo) GN=fusA2 PE=3 SV=1 51 819 9.0E-102
sp|A7GJ77|EFG_CLOBL Elongation factor G OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=fusA PE=3 SV=1 40 818 1.0E-101
sp|B1IGF7|EFG_CLOBK Elongation factor G OS=Clostridium botulinum (strain Okra / Type B1) GN=fusA PE=3 SV=1 40 818 1.0E-101
sp|Q2JFH9|EFG_FRASC Elongation factor G OS=Frankia sp. (strain CcI3) GN=fusA PE=3 SV=1 48 818 1.0E-101
sp|A5I7K9|EFG_CLOBH Elongation factor G OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=fusA PE=3 SV=1 40 818 1.0E-101
sp|A7FZ72|EFG_CLOB1 Elongation factor G OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=fusA PE=3 SV=1 40 818 1.0E-101
sp|P13550|EFG_ARTPT Elongation factor G OS=Arthrospira platensis GN=fusA PE=3 SV=1 48 818 1.0E-101
sp|B0K5P0|EFG_THEPX Elongation factor G OS=Thermoanaerobacter sp. (strain X514) GN=fusA PE=3 SV=1 45 818 1.0E-101
sp|B0KCJ7|EFG_THEP3 Elongation factor G OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=fusA PE=3 SV=1 45 818 1.0E-101
sp|Q6F0J4|EFG_MESFL Elongation factor G OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fusA PE=3 SV=1 47 816 1.0E-101
sp|Q1ISC5|EFG_KORVE Elongation factor G OS=Koribacter versatilis (strain Ellin345) GN=fusA PE=3 SV=1 48 815 2.0E-101
sp|B6J266|EFG_COXB2 Elongation factor G OS=Coxiella burnetii (strain CbuG_Q212) GN=fusA PE=3 SV=1 48 816 2.0E-101
sp|Q0AIJ8|EFG_NITEC Elongation factor G OS=Nitrosomonas eutropha (strain C91) GN=fusA PE=3 SV=1 43 816 2.0E-101
sp|A4IJI6|EFG_GEOTN Elongation factor G OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fusA PE=3 SV=1 47 818 2.0E-101
sp|Q7VJ85|EFG_HELHP Elongation factor G OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=fusA PE=3 SV=1 48 818 2.0E-101
sp|A2RCI2|EFG_STRPG Elongation factor G OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fusA PE=3 SV=1 47 818 2.0E-101
sp|Q4A703|EFG_MYCS5 Elongation factor G OS=Mycoplasma synoviae (strain 53) GN=fusA PE=3 SV=1 42 817 2.0E-101
sp|B3EUF3|EFG_AMOA5 Elongation factor G OS=Amoebophilus asiaticus (strain 5a2) GN=fusA PE=3 SV=1 48 818 3.0E-101
sp|B2J5B0|EFG_NOSP7 Elongation factor G OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=fusA PE=3 SV=1 48 818 3.0E-101
sp|A9KD34|EFG_COXBN Elongation factor G OS=Coxiella burnetii (strain Dugway 5J108-111) GN=fusA PE=3 SV=1 48 816 3.0E-101
sp|A1W2Q4|EFG_ACISJ Elongation factor G OS=Acidovorax sp. (strain JS42) GN=fusA PE=3 SV=1 48 816 3.0E-101
sp|Q03PV4|EFG_LACBA Elongation factor G OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fusA PE=3 SV=1 48 815 3.0E-101
sp|A0LRL7|EFG_ACIC1 Elongation factor G OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fusA PE=3 SV=1 46 818 3.0E-101
sp|Q87A35|EFG_XYLFT Elongation factor G OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fusA PE=3 SV=1 52 815 3.0E-101
sp|B2IA64|EFG_XYLF2 Elongation factor G OS=Xylella fastidiosa (strain M23) GN=fusA PE=3 SV=1 52 815 3.0E-101
sp|Q83ES7|EFG_COXBU Elongation factor G OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fusA PE=3 SV=1 48 816 3.0E-101
sp|A9NAM1|EFG_COXBR Elongation factor G OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=fusA PE=3 SV=1 48 816 3.0E-101
sp|B2FQ42|EFG_STRMK Elongation factor G OS=Stenotrophomonas maltophilia (strain K279a) GN=fusA PE=3 SV=1 48 815 3.0E-101
sp|Q2IJ93|EFG1_ANADE Elongation factor G 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=fusA1 PE=3 SV=1 48 818 4.0E-101
sp|C0R543|EFG_WOLWR Elongation factor G OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=fusA PE=3 SV=1 52 818 4.0E-101
sp|Q73IX7|EFG_WOLPM Elongation factor G OS=Wolbachia pipientis wMel GN=fusA PE=3 SV=1 52 818 4.0E-101
sp|C3KVQ4|EFG_CLOB6 Elongation factor G OS=Clostridium botulinum (strain 657 / Type Ba4) GN=fusA PE=3 SV=1 40 818 4.0E-101
sp|B6J5C9|EFG_COXB1 Elongation factor G OS=Coxiella burnetii (strain CbuK_Q154) GN=fusA PE=3 SV=1 48 816 4.0E-101
sp|B4U741|EFG_HYDS0 Elongation factor G OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=fusA PE=3 SV=1 48 822 4.0E-101
sp|B3QY21|EFG_CHLT3 Elongation factor G OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=fusA PE=3 SV=1 48 818 4.0E-101
sp|Q8CQ82|EFG_STAES Elongation factor G OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fusA PE=3 SV=3 45 818 5.0E-101
sp|Q5HRK5|EFG_STAEQ Elongation factor G OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fusA PE=3 SV=3 45 818 5.0E-101
sp|Q9PA90|EFG_XYLFA Elongation factor G OS=Xylella fastidiosa (strain 9a5c) GN=fusA PE=3 SV=1 52 815 5.0E-101
sp|Q6ACY9|EFG_LEIXX Elongation factor G OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=fusA PE=3 SV=1 48 818 5.0E-101
sp|Q3AMT5|EFG_SYNSC Elongation factor G OS=Synechococcus sp. (strain CC9605) GN=fusA PE=3 SV=1 45 818 5.0E-101
sp|Q5HC12|EFG_EHRRW Elongation factor G OS=Ehrlichia ruminantium (strain Welgevonden) GN=fusA PE=3 SV=1 43 818 6.0E-101
sp|Q5FFE7|EFG_EHRRG Elongation factor G OS=Ehrlichia ruminantium (strain Gardel) GN=fusA PE=3 SV=1 43 818 6.0E-101
sp|A3CQM2|EFG_STRSV Elongation factor G OS=Streptococcus sanguinis (strain SK36) GN=fusA PE=3 SV=1 47 818 6.0E-101
sp|P09952|EFG_MICLU Elongation factor G OS=Micrococcus luteus GN=fusA PE=3 SV=1 48 818 6.0E-101
sp|A7GK17|EFG_BACCN Elongation factor G OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=fusA PE=3 SV=1 47 818 6.0E-101
sp|Q8R602|EFG_FUSNN Elongation factor G OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fusA PE=3 SV=1 47 818 8.0E-101
sp|Q73SD2|EFG_MYCPA Elongation factor G OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=fusA PE=3 SV=1 48 818 8.0E-101
sp|A0QL36|EFG_MYCA1 Elongation factor G OS=Mycobacterium avium (strain 104) GN=fusA PE=3 SV=1 48 818 8.0E-101
sp|Q2GD82|EFG_NEOSM Elongation factor G OS=Neorickettsia sennetsu (strain Miyayama) GN=fusA PE=3 SV=1 48 821 8.0E-101
sp|Q98QD8|EFG_MYCPU Elongation factor G OS=Mycoplasma pulmonis (strain UAB CTIP) GN=fusA PE=3 SV=2 40 817 8.0E-101
sp|Q2SSW9|EFG_MYCCT Elongation factor G OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fusA PE=3 SV=1 42 816 9.0E-101
sp|Q1H4P0|EFG_METFK Elongation factor G OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fusA PE=3 SV=1 48 816 9.0E-101
sp|B0U5X3|EFG_XYLFM Elongation factor G OS=Xylella fastidiosa (strain M12) GN=fusA PE=3 SV=1 52 815 9.0E-101
sp|B9JDS6|EFG_AGRRK Elongation factor G OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=fusA PE=3 SV=1 42 818 1.0E-100
sp|B8HVR8|EFG_CYAP4 Elongation factor G OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=fusA PE=3 SV=1 48 818 1.0E-100
sp|A6U856|EFG_SINMW Elongation factor G OS=Sinorhizobium medicae (strain WSM419) GN=fusA PE=3 SV=1 42 818 1.0E-100
sp|A6LPQ8|EFG_CLOB8 Elongation factor G OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=fusA PE=3 SV=1 48 818 1.0E-100
sp|B4S5N0|EFG_PROA2 Elongation factor G OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=fusA PE=3 SV=1 48 818 1.0E-100
sp|Q250N5|EFG_DESHY Elongation factor G OS=Desulfitobacterium hafniense (strain Y51) GN=fusA PE=3 SV=1 48 826 1.0E-100
sp|B8G1W3|EFG_DESHD Elongation factor G OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=fusA PE=3 SV=1 48 826 1.0E-100
sp|Q3APH0|EFG_CHLCH Elongation factor G OS=Chlorobium chlorochromatii (strain CaD3) GN=fusA PE=3 SV=1 47 818 1.0E-100
sp|Q5GSU1|EFG_WOLTR Elongation factor G OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=fusA PE=3 SV=1 52 818 2.0E-100
sp|B9E8Q1|EFG_MACCJ Elongation factor G OS=Macrococcus caseolyticus (strain JCSC5402) GN=fusA PE=3 SV=1 47 818 2.0E-100
sp|Q6MU82|EFG_MYCMS Elongation factor G OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=fusA PE=3 SV=1 42 816 2.0E-100
sp|B3EP64|EFG_CHLPB Elongation factor G OS=Chlorobium phaeobacteroides (strain BS1) GN=fusA PE=3 SV=1 47 818 2.0E-100
sp|Q30TP3|EFG_SULDN Elongation factor G OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=fusA PE=3 SV=1 46 818 2.0E-100
sp|B1KSM8|EFG_CLOBM Elongation factor G OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=fusA PE=3 SV=1 40 818 2.0E-100
sp|C1FMV4|EFG_CLOBJ Elongation factor G OS=Clostridium botulinum (strain Kyoto / Type A2) GN=fusA PE=3 SV=1 40 818 2.0E-100
sp|Q3B6G4|EFG_CHLL7 Elongation factor G OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=fusA PE=3 SV=1 47 818 2.0E-100
sp|Q123W3|EFG2_POLSJ Elongation factor G 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=fusA2 PE=3 SV=1 48 815 2.0E-100
sp|B3CLA3|EFG_WOLPP Elongation factor G OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=fusA PE=3 SV=1 52 818 3.0E-100
sp|A1BJ37|EFG_CHLPD Elongation factor G OS=Chlorobium phaeobacteroides (strain DSM 266) GN=fusA PE=3 SV=1 47 818 3.0E-100
sp|B8D0C1|EFG_HALOH Elongation factor G OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fusA PE=3 SV=1 48 818 3.0E-100
sp|Q38UQ9|EFG_LACSS Elongation factor G OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fusA PE=3 SV=1 48 818 3.0E-100
sp|C1CXH0|EFG_DEIDV Elongation factor G OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=fusA PE=3 SV=1 48 818 3.0E-100
sp|B3EH94|EFG_CHLL2 Elongation factor G OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=fusA PE=3 SV=1 48 818 3.0E-100
sp|B0S0I4|EFG_FINM2 Elongation factor G OS=Finegoldia magna (strain ATCC 29328) GN=fusA PE=3 SV=1 47 818 4.0E-100
sp|B2V7L6|EFG_SULSY Elongation factor G OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fusA PE=3 SV=1 48 821 4.0E-100
sp|Q4FLL6|EFG_PELUB Elongation factor G OS=Pelagibacter ubique (strain HTCC1062) GN=fusA PE=3 SV=1 46 818 4.0E-100
sp|Q30Z38|EFG_DESAG Elongation factor G OS=Desulfovibrio alaskensis (strain G20) GN=fusA PE=3 SV=1 52 818 5.0E-100
sp|C3MAX7|EFG_RHISN Elongation factor G OS=Rhizobium sp. (strain NGR234) GN=fusA PE=3 SV=1 42 818 5.0E-100
sp|A4QBG9|EFG_CORGB Elongation factor G OS=Corynebacterium glutamicum (strain R) GN=fusA PE=3 SV=1 48 818 5.0E-100
sp|A4XI36|EFG_CALS8 Elongation factor G OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fusA PE=3 SV=1 48 818 5.0E-100
sp|Q8E3E7|EFG_STRA3 Elongation factor G OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fusA PE=3 SV=1 47 818 6.0E-100
sp|B4EYV7|EFG_PROMH Elongation factor G OS=Proteus mirabilis (strain HI4320) GN=fusA PE=3 SV=1 52 812 6.0E-100
sp|Q1IX68|EFG_DEIGD Elongation factor G OS=Deinococcus geothermalis (strain DSM 11300) GN=fusA PE=3 SV=1 48 818 6.0E-100
sp|B5EFP7|EFG_GEOBB Elongation factor G OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fusA PE=3 SV=1 47 818 6.0E-100
sp|Q4AAQ6|EFG_MYCHJ Elongation factor G OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=fusA PE=3 SV=2 48 815 7.0E-100
sp|Q4A8T7|EFG_MYCH7 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 7448) GN=fusA PE=3 SV=2 48 815 7.0E-100
sp|Q601W8|EFG_MYCH2 Elongation factor G OS=Mycoplasma hyopneumoniae (strain 232) GN=fusA PE=3 SV=1 48 815 7.0E-100
sp|Q8NT19|EFG_CORGL Elongation factor G OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fusA PE=3 SV=1 48 818 7.0E-100
sp|Q11HP9|EFG_CHESB Elongation factor G OS=Chelativorans sp. (strain BNC1) GN=fusA PE=3 SV=1 48 818 8.0E-100
sp|Q1MPS9|EFG_LAWIP Elongation factor G OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=fusA PE=3 SV=1 48 818 8.0E-100
sp|B8HD12|EFG_ARTCA Elongation factor G OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=fusA PE=3 SV=1 48 818 8.0E-100
sp|Q2RQV7|EFG_RHORT Elongation factor G OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=fusA PE=3 SV=1 45 818 1.0E-99
sp|Q98N59|EFG_RHILO Elongation factor G OS=Rhizobium loti (strain MAFF303099) GN=fusA PE=3 SV=1 42 818 1.0E-99
sp|A3DIZ9|EFG_CLOTH Elongation factor G OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=fusA PE=3 SV=1 47 818 1.0E-99
sp|I1K0K6|EFGC2_SOYBN Elongation factor G-2, chloroplastic OS=Glycine max GN=fusA2 PE=3 SV=1 48 826 1.0E-99
sp|Q6A6L5|EFG_PROAC Elongation factor G OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=fusA PE=3 SV=1 48 816 1.0E-99
sp|Q8DXS7|EFG_STRA5 Elongation factor G OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fusA PE=3 SV=1 47 818 2.0E-99
sp|Q3JZB5|EFG_STRA1 Elongation factor G OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fusA PE=3 SV=1 47 818 2.0E-99
sp|A7HM55|EFG_FERNB Elongation factor G OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=fusA PE=3 SV=1 48 818 2.0E-99
sp|Q65PB0|EFG_BACLD Elongation factor G OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fusA PE=3 SV=1 47 818 2.0E-99
sp|A3PEZ8|EFG_PROM0 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9301) GN=fusA PE=3 SV=1 45 818 2.0E-99
sp|O51634|EFG2_BORBU Elongation factor G 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fusB PE=3 SV=1 50 815 2.0E-99
sp|B9JVN4|EFG_AGRVS Elongation factor G OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=fusA PE=3 SV=1 42 818 2.0E-99
sp|A1VEB9|EFG_DESVV Elongation factor G OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=fusA PE=3 SV=1 52 818 2.0E-99
sp|Q72CI3|EFG_DESVH Elongation factor G OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=fusA PE=3 SV=1 52 818 2.0E-99
sp|A5CUB7|EFG_CLAM3 Elongation factor G OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=fusA PE=3 SV=1 48 818 2.0E-99
sp|Q660H9|EFG2_BORBP Elongation factor G 2 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=fusA2 PE=3 SV=1 50 820 3.0E-99
sp|Q0ANP7|EFG_MARMM Elongation factor G OS=Maricaulis maris (strain MCS10) GN=fusA PE=3 SV=1 45 818 3.0E-99
sp|Q8UE15|EFG_AGRFC Elongation factor G OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fusA PE=3 SV=1 42 818 3.0E-99
sp|Q0AXN1|EFG1_SYNWW Elongation factor G 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=fusA1 PE=3 SV=1 48 815 3.0E-99
sp|B5ZYT2|EFG_RHILW Elongation factor G OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=fusA PE=3 SV=1 42 818 3.0E-99
sp|A5N4P4|EFG_CLOK5 Elongation factor G OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=fusA PE=3 SV=1 48 818 3.0E-99
sp|B9DYA6|EFG_CLOK1 Elongation factor G OS=Clostridium kluyveri (strain NBRC 12016) GN=fusA PE=3 SV=1 48 818 3.0E-99
sp|Q3AW54|EFG_SYNS9 Elongation factor G OS=Synechococcus sp. (strain CC9902) GN=fusA PE=3 SV=1 48 818 4.0E-99
sp|A8LC59|EFG_FRASN Elongation factor G OS=Frankia sp. (strain EAN1pec) GN=fusA PE=3 SV=1 52 818 5.0E-99
sp|B1YGU7|EFG_EXIS2 Elongation factor G OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=fusA PE=3 SV=1 47 818 5.0E-99
sp|Q7VA04|EFG_PROMA Elongation factor G OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fusA PE=3 SV=1 48 818 5.0E-99
sp|B1MGH8|EFG_MYCA9 Elongation factor G OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=fusA PE=3 SV=1 48 818 5.0E-99
sp|C0ZIH5|EFG_BREBN Elongation factor G OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=fusA PE=3 SV=1 47 818 6.0E-99
sp|A1T4L5|EFG_MYCVP Elongation factor G OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=fusA PE=3 SV=1 48 818 6.0E-99
sp|B4R8L3|EFG_PHEZH Elongation factor G OS=Phenylobacterium zucineum (strain HLK1) GN=fusA PE=3 SV=1 46 818 7.0E-99
sp|Q1D777|EFG2_MYXXD Elongation factor G 2 OS=Myxococcus xanthus (strain DK 1622) GN=fusA2 PE=3 SV=1 48 816 7.0E-99
sp|B9MQH0|EFG_CALBD Elongation factor G OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=fusA PE=3 SV=1 48 818 7.0E-99
sp|B0RB35|EFG_CLAMS Elongation factor G OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=fusA PE=3 SV=1 48 818 7.0E-99
sp|Q5U8S9|EFG_STAIN Elongation factor G OS=Staphylococcus intermedius GN=fusA PE=3 SV=3 45 818 8.0E-99
sp|Q4L3K8|EFG_STAHJ Elongation factor G OS=Staphylococcus haemolyticus (strain JCSC1435) GN=fusA PE=3 SV=1 45 818 8.0E-99
sp|Q6MER8|EFG_PARUW Elongation factor G OS=Protochlamydia amoebophila (strain UWE25) GN=fusA PE=3 SV=1 42 818 9.0E-99
sp|O66428|EFG_AQUAE Elongation factor G OS=Aquifex aeolicus (strain VF5) GN=fusA PE=3 SV=1 48 818 1.0E-98
sp|B3E7T2|EFG_GEOLS Elongation factor G OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fusA PE=3 SV=1 48 818 1.0E-98
sp|Q92QH2|EFG_RHIME Elongation factor G OS=Rhizobium meliloti (strain 1021) GN=fusA PE=3 SV=1 42 818 1.0E-98
sp|B0TC53|EFG_HELMI Elongation factor G OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fusA PE=3 SV=1 48 812 1.0E-98
sp|Q7NEF2|EFG_GLOVI Elongation factor G OS=Gloeobacter violaceus (strain PCC 7421) GN=fusA PE=3 SV=1 48 818 1.0E-98
sp|Q8K948|EFG_BUCAP Elongation factor G OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fusA PE=3 SV=1 52 812 1.0E-98
sp|Q1MIE4|EFG_RHIL3 Elongation factor G OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=fusA PE=3 SV=1 42 818 1.0E-98
sp|C5BGM8|EFG_EDWI9 Elongation factor G OS=Edwardsiella ictaluri (strain 93-146) GN=fusA PE=3 SV=1 52 816 2.0E-98
sp|B4SBU4|EFG_PELPB Elongation factor G OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=fusA PE=3 SV=1 48 818 2.0E-98
sp|Q97EH4|EFG_CLOAB Elongation factor G OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=fusA PE=3 SV=1 48 813 2.0E-98
sp|Q3J8R1|EFG_NITOC Elongation factor G OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fusA PE=3 SV=1 48 815 2.0E-98
sp|Q7VNA2|EFG_HAEDU Elongation factor G OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fusA PE=3 SV=1 52 810 2.0E-98
sp|B1GZ80|EFG_UNCTG Elongation factor G OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=fusA PE=3 SV=1 48 818 3.0E-98
sp|P34811|EFGC1_SOYBN Elongation factor G-1, chloroplastic OS=Glycine max GN=fusA1 PE=3 SV=2 24 826 3.0E-98
sp|C0QQM0|EFG_PERMH Elongation factor G OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=fusA PE=3 SV=1 48 818 3.0E-98
sp|A5WGL0|EFG_PSYWF Elongation factor G OS=Psychrobacter sp. (strain PRwf-1) GN=fusA PE=3 SV=1 48 816 3.0E-98
sp|A1AVJ7|EFG_RUTMC Elongation factor G OS=Ruthia magnifica subsp. Calyptogena magnifica GN=fusA PE=3 SV=1 48 815 4.0E-98
sp|A8F981|EFG_BACP2 Elongation factor G OS=Bacillus pumilus (strain SAFR-032) GN=fusA PE=3 SV=1 47 818 4.0E-98
sp|A4G9U1|EFG_HERAR Elongation factor G OS=Herminiimonas arsenicoxydans GN=fusA PE=3 SV=1 48 816 4.0E-98
sp|B3WAM2|EFG_LACCB Elongation factor G OS=Lactobacillus casei (strain BL23) GN=fusA PE=3 SV=1 48 818 4.0E-98
sp|Q83JC3|EFG_SHIFL Elongation factor G OS=Shigella flexneri GN=fusA PE=3 SV=3 52 812 4.0E-98
sp|Q0SZX7|EFG_SHIF8 Elongation factor G OS=Shigella flexneri serotype 5b (strain 8401) GN=fusA PE=3 SV=1 52 812 4.0E-98
sp|Q1BRU5|EFG2_BURCA Elongation factor G 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA2 PE=3 SV=1 48 816 4.0E-98
sp|Q3YWT2|EFG_SHISS Elongation factor G OS=Shigella sonnei (strain Ss046) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|Q32B26|EFG_SHIDS Elongation factor G OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|Q31VU9|EFG_SHIBS Elongation factor G OS=Shigella boydii serotype 4 (strain Sb227) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B2U2U7|EFG_SHIB3 Elongation factor G OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B7LS46|EFG_ESCF3 Elongation factor G OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|Q1R5U3|EFG_ECOUT Elongation factor G OS=Escherichia coli (strain UTI89 / UPEC) GN=fusA PE=3 SV=3 52 812 5.0E-98
sp|B1LHE0|EFG_ECOSM Elongation factor G OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B6I240|EFG_ECOSE Elongation factor G OS=Escherichia coli (strain SE11) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|P0A6M8|EFG_ECOLI Elongation factor G OS=Escherichia coli (strain K12) GN=fusA PE=1 SV=2 52 812 5.0E-98
sp|B1IPV9|EFG_ECOLC Elongation factor G OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|P0A6M9|EFG_ECOL6 Elongation factor G OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fusA PE=3 SV=2 52 812 5.0E-98
sp|Q0TCB9|EFG_ECOL5 Elongation factor G OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fusA PE=3 SV=3 52 812 5.0E-98
sp|A1AGM7|EFG_ECOK1 Elongation factor G OS=Escherichia coli O1:K1 / APEC GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|A8A5E7|EFG_ECOHS Elongation factor G OS=Escherichia coli O9:H4 (strain HS) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B1X6J0|EFG_ECODH Elongation factor G OS=Escherichia coli (strain K12 / DH10B) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|C4ZUJ5|EFG_ECOBW Elongation factor G OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B7M1P1|EFG_ECO8A Elongation factor G OS=Escherichia coli O8 (strain IAI1) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B7N0X6|EFG_ECO81 Elongation factor G OS=Escherichia coli O81 (strain ED1a) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B7NLP5|EFG_ECO7I Elongation factor G OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B5YTP7|EFG_ECO5E Elongation factor G OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|P0A6N0|EFG_ECO57 Elongation factor G OS=Escherichia coli O157:H7 GN=fusA PE=3 SV=2 52 812 5.0E-98
sp|B7L4L1|EFG_ECO55 Elongation factor G OS=Escherichia coli (strain 55989 / EAEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B7MCV5|EFG_ECO45 Elongation factor G OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|B7UK50|EFG_ECO27 Elongation factor G OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|A7ZSL5|EFG_ECO24 Elongation factor G OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fusA PE=3 SV=1 52 812 5.0E-98
sp|Q49V57|EFG_STAS1 Elongation factor G OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=fusA PE=3 SV=1 45 818 5.0E-98
sp|Q31IY5|EFG_THICR Elongation factor G OS=Thiomicrospira crunogena (strain XCL-2) GN=fusA PE=3 SV=1 48 812 5.0E-98
sp|B9DVS2|EFG_STRU0 Elongation factor G OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fusA PE=3 SV=1 47 818 5.0E-98
sp|P80868|EFG_BACSU Elongation factor G OS=Bacillus subtilis (strain 168) GN=fusA PE=1 SV=3 47 818 6.0E-98
sp|Q034X8|EFG_LACC3 Elongation factor G OS=Lactobacillus casei (strain ATCC 334) GN=fusA PE=3 SV=1 48 818 6.0E-98
sp|P57938|EFG_PASMU Elongation factor G OS=Pasteurella multocida (strain Pm70) GN=fusA PE=3 SV=1 48 810 7.0E-98
sp|A1R8V0|EFG_ARTAT Elongation factor G OS=Arthrobacter aurescens (strain TC1) GN=fusA PE=3 SV=1 48 818 7.0E-98
sp|A0M5A0|EFG_GRAFK Elongation factor G OS=Gramella forsetii (strain KT0803) GN=fusA PE=3 SV=1 48 816 7.0E-98
sp|Q3ILP5|EFG1_PSEHT Elongation factor G 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fusA1 PE=3 SV=1 48 821 7.0E-98
sp|P30767|EFG_MYCLE Elongation factor G OS=Mycobacterium leprae (strain TN) GN=fusA PE=3 SV=2 48 818 7.0E-98
sp|B8ZSC2|EFG_MYCLB Elongation factor G OS=Mycobacterium leprae (strain Br4923) GN=fusA PE=3 SV=1 48 818 7.0E-98
sp|B2RLZ4|EFG_PORG3 Elongation factor G OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=fusA PE=3 SV=1 43 818 8.0E-98
sp|Q7MTL1|EFG_PORGI Elongation factor G OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=fusA PE=3 SV=1 43 818 8.0E-98
sp|A2S7H3|EFG_BURM9 Elongation factor G OS=Burkholderia mallei (strain NCTC 10229) GN=fusA PE=3 SV=1 48 816 8.0E-98
sp|Q2SU24|EFG2_BURTA Elongation factor G 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA2 PE=3 SV=1 48 816 8.0E-98
sp|Q63Q08|EFG2_BURPS Elongation factor G 2 OS=Burkholderia pseudomallei (strain K96243) GN=fusA2 PE=3 SV=1 48 816 8.0E-98
sp|Q3JMR0|EFG2_BURP1 Elongation factor G 2 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA2 PE=3 SV=1 48 816 8.0E-98
sp|Q62GK2|EFG2_BURMA Elongation factor G 2 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA2 PE=3 SV=1 48 816 8.0E-98
sp|Q7UZY6|EFG_PROMP Elongation factor G OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fusA PE=3 SV=1 45 818 8.0E-98
sp|Q2YB00|EFG_NITMU Elongation factor G OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=fusA PE=3 SV=1 48 816 8.0E-98
sp|A8G709|EFG_PROM2 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9215) GN=fusA PE=3 SV=1 45 818 9.0E-98
sp|B2GIL1|EFG_KOCRD Elongation factor G OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=fusA PE=3 SV=1 48 818 9.0E-98
sp|B4RQX2|EFG_NEIG2 Elongation factor G OS=Neisseria gonorrhoeae (strain NCCP11945) GN=fusA PE=3 SV=1 52 821 1.0E-97
sp|Q5F5S3|EFG_NEIG1 Elongation factor G OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fusA PE=3 SV=1 52 821 1.0E-97
sp|B8I5N7|EFG_CLOCE Elongation factor G OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=fusA PE=3 SV=1 42 818 1.0E-97
sp|A0PM41|EFG_MYCUA Elongation factor G OS=Mycobacterium ulcerans (strain Agy99) GN=fusA PE=3 SV=1 48 818 1.0E-97
sp|A6T3K7|EFG_JANMA Elongation factor G OS=Janthinobacterium sp. (strain Marseille) GN=fusA PE=3 SV=1 48 816 1.0E-97
sp|A5GIP1|EFG_SYNPW Elongation factor G OS=Synechococcus sp. (strain WH7803) GN=fusA PE=3 SV=1 48 818 1.0E-97
sp|Q2T0I7|EFG1_BURTA Elongation factor G 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fusA1 PE=3 SV=1 48 816 1.0E-97
sp|B2HSL2|EFG_MYCMM Elongation factor G OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fusA PE=3 SV=1 48 818 1.0E-97
sp|C4KZQ0|EFG_EXISA Elongation factor G OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=fusA PE=3 SV=1 47 818 1.0E-97
sp|Q318N4|EFG_PROM9 Elongation factor G OS=Prochlorococcus marinus (strain MIT 9312) GN=fusA PE=3 SV=1 45 818 1.0E-97
sp|Q2L2H1|EFG1_BORA1 Elongation factor G 1 OS=Bordetella avium (strain 197N) GN=fusA1 PE=3 SV=1 48 816 1.0E-97
sp|Q73R08|EFG1_TREDE Elongation factor G 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fusA1 PE=3 SV=1 48 815 1.0E-97
sp|A9WSW6|EFG_RENSM Elongation factor G OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=fusA PE=3 SV=1 48 818 2.0E-97
sp|Q1BU86|EFG1_BURCA Elongation factor G 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=fusA1 PE=3 SV=2 48 816 2.0E-97
sp|Q8Y421|EFG_LISMO Elongation factor G OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fusA PE=3 SV=1 47 818 2.0E-97
sp|B8DAY6|EFG_LISMH Elongation factor G OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=fusA PE=3 SV=1 47 818 2.0E-97
sp|Q71WB8|EFG_LISMF Elongation factor G OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fusA PE=3 SV=1 47 818 2.0E-97
sp|C1KZK7|EFG_LISMC Elongation factor G OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=fusA PE=3 SV=1 47 818 2.0E-97
sp|B9L7K0|EFG_NAUPA Elongation factor G OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=fusA PE=3 SV=1 48 818 2.0E-97
sp|Q9RXK5|EFG_DEIRA Elongation factor G OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fusA PE=3 SV=1 48 818 2.0E-97
sp|A2BT84|EFG_PROMS Elongation factor G OS=Prochlorococcus marinus (strain AS9601) GN=fusA PE=3 SV=1 45 818 2.0E-97
sp|Q7WFL2|EFG2_BORBR Elongation factor G 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fusA2 PE=3 SV=1 46 816 2.0E-97
sp|Q67JU0|EFG_SYMTH Elongation factor G OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=fusA PE=3 SV=1 47 818 3.0E-97
sp|A0ALY9|EFG_LISW6 Elongation factor G OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=fusA PE=3 SV=1 47 818 3.0E-97
sp|Q2S909|EFG1_HAHCH Elongation factor G 1 OS=Hahella chejuensis (strain KCTC 2396) GN=fusA1 PE=3 SV=1 48 816 3.0E-97
sp|B4SKW0|EFG_STRM5 Elongation factor G OS=Stenotrophomonas maltophilia (strain R551-3) GN=fusA PE=3 SV=1 48 815 3.0E-97
sp|B9DKV7|EFG_STACT Elongation factor G OS=Staphylococcus carnosus (strain TM300) GN=fusA PE=3 SV=1 45 818 3.0E-97
sp|Q39DL2|EFG2_BURL3 Elongation factor G 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=fusA2 PE=3 SV=1 48 826 4.0E-97
sp|Q0ID58|EFG_SYNS3 Elongation factor G OS=Synechococcus sp. (strain CC9311) GN=fusA PE=3 SV=1 45 818 4.0E-97
sp|Q6FDS6|EFG_ACIAD Elongation factor G OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fusA PE=3 SV=1 48 816 4.0E-97
sp|P70782|EFG_RHIRD Elongation factor G OS=Rhizobium radiobacter GN=fusA PE=3 SV=1 42 818 5.0E-97
sp|A0L5X0|EFG_MAGMM Elongation factor G OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=fusA PE=3 SV=1 47 818 5.0E-97
sp|Q5WLR5|EFG_BACSK Elongation factor G OS=Bacillus clausii (strain KSM-K16) GN=fusA PE=3 SV=1 47 818 5.0E-97
sp|Q03EB4|EFG_PEDPA Elongation factor G OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=fusA PE=3 SV=1 48 818 5.0E-97
sp|B8DN94|EFG_DESVM Elongation factor G OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=fusA PE=3 SV=1 48 818 6.0E-97
sp|Q927I5|EFG_LISIN Elongation factor G OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fusA PE=3 SV=1 47 818 6.0E-97
sp|Q9K1I8|EFG_NEIMB Elongation factor G OS=Neisseria meningitidis serogroup B (strain MC58) GN=fusA PE=1 SV=1 52 821 6.0E-97
sp|Q63WJ7|EFG1_BURPS Elongation factor G 1 OS=Burkholderia pseudomallei (strain K96243) GN=fusA1 PE=3 SV=1 48 816 7.0E-97
sp|Q62HK4|EFG1_BURMA Elongation factor G 1 OS=Burkholderia mallei (strain ATCC 23344) GN=fusA1 PE=3 SV=1 48 816 7.0E-97
sp|Q3JV86|EFG1_BURP1 Elongation factor G 1 OS=Burkholderia pseudomallei (strain 1710b) GN=fusA1 PE=3 SV=2 48 816 8.0E-97
sp|Q890N8|EFG_CLOTE Elongation factor G OS=Clostridium tetani (strain Massachusetts / E88) GN=fusA PE=3 SV=1 39 818 8.0E-97
sp|B1JIV5|EFG_YERPY Elongation factor G OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fusA PE=3 SV=1 48 816 1.0E-96
sp|Q664R6|EFG_YERPS Elongation factor G OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fusA PE=3 SV=1 48 816 1.0E-96
sp|A4TGY6|EFG_YERPP Elongation factor G OS=Yersinia pestis (strain Pestoides F) GN=fusA PE=3 SV=1 48 816 1.0E-96
sp|Q1CCT8|EFG_YERPN Elongation factor G OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fusA PE=3 SV=1 48 816 1.0E-96
sp|A9R462|EFG_YERPG Elongation factor G OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fusA PE=3 SV=1 48 816 1.0E-96
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0032561 guanyl ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1755
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1410
Ophiocordyceps australis map64 (Brazil) OphauB2|2727 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04105
Ophiocordyceps camponoti-rufipedis Ophun1|6159
Ophiocordyceps kimflemingae Ophio5|3979
Ophiocordyceps subramaniannii Hirsu2|165

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2727
MSRSLYSTAGFALKHLFTTTETCSPQRIGFSRCQAHSQACNRSYDNSLENIRNIGIIAHVDAGKTTTTERMLYYS
GVTQRVGDVDSGNTVTDFLELERARGITIQSAAITFPWPPLAECPAGMQPKMINLIDTPGHQDFRFEVDRCLPIL
DGAVCIIDSVKGVEAHTERVWASAHDFGIPRIVYCNKLDRDGASFRKSVLDIGARLKGWPLVCQIPWWERDVFVG
VIDIIDRVGYRWKSMQQKTFYDSQQLSDVLKRSNESLLNEMQVARQRLIEGLAEFDEAVMDEYLAENPDIPTCLL
KDGIRRAIQSGDGRAIPVFAGSSSRHIGIEPLMDAITEYLPSPIQRPDVEVYLGSSKHKLSDALQTEKNQGGRSS
VTSVASIFKVFNHPKEGVLSFVRVYHGTLMRNASTYNTNLMLQERPMGIVQVSASKTQEIAELSVGQIGAIRGLK
KARSGDTLIATTTSGKAVPEVLRQMRIRPPEIPPPVAFLQADAYGLVAAEQLAKALENASREDPSLRWNRDAKTD
QFTIQGMGKLHLEVSLHNIRQKHQIDAEFGQIEVDYKECITIATAPQYAVFDRCIASKTGKAACTVVLEPMDAQE
LNAPNKMGLERDGNLFQVEIASTNASKELGFDVEEARQQLINGAIAGLARGPRRASPVHSCRVRVTLDTSPGALE
SPSGGHFSSAARTATQAALREAHSKQQVVILEPIMLTHITCPETVAGTVQHDIMAGAGGHVLEVSDRSAESTGQD
GIDVSSIYAPRDPYDSITSLRGKKSTSRVVEIVAKVPYKEMLGYDEHLRSKTAGRHSMTMSFDSFARVVGHREKG
L*
Coding >OphauB2|2727
ATGTCGCGTTCCCTATACAGCACAGCGGGGTTTGCGTTGAAGCACTTGTTCACTACAACGGAGACCTGCTCTCCG
CAACGAATTGGATTTTCCAGATGCCAAGCGCATAGTCAAGCATGTAATCGATCCTATGACAATAGTCTCGAAAAC
ATTCGCAACATTGGCATTATTGCCCATGTCGACGCTGGGAAAACCACGACGACTGAGCGCATGCTATACTACAGC
GGCGTTACGCAGAGAGTCGGTGATGTCGATTCTGGAAACACCGTCACCGACTTTCTCGAGCTCGAAAGAGCGCGA
GGTATCACAATTCAGTCAGCCGCAATTACTTTTCCATGGCCGCCACTAGCAGAATGCCCCGCGGGAATGCAGCCC
AAGATGATCAACCTCATTGACACTCCTGGCCATCAGGACTTTAGGTTCGAGGTAGACCGCTGCCTCCCCATTCTT
GATGGCGCTGTCTGCATCATTGATTCAGTCAAGGGCGTCGAGGCCCATACGGAGCGAGTGTGGGCGTCTGCCCAT
GACTTTGGCATTCCTCGCATCGTTTACTGCAACAAGCTCGACCGCGATGGCGCCTCGTTCAGAAAATCAGTGCTC
GATATTGGTGCACGCCTCAAGGGCTGGCCTCTAGTCTGTCAAATTCCCTGGTGGGAAAGGGATGTTTTTGTTGGT
GTTATTGACATCATTGACCGAGTAGGATATCGATGGAAATCTATGCAGCAAAAGACGTTTTACGACTCTCAGCAG
CTATCAGACGTGCTCAAGCGCTCAAATGAGTCACTGCTCAATGAAATGCAGGTTGCTAGGCAGCGACTGATTGAG
GGGCTTGCGGAATTCGACGAAGCCGTTATGGACGAGTACTTGGCTGAAAACCCGGATATTCCGACATGTCTCTTG
AAAGATGGAATCCGACGAGCTATTCAAAGTGGCGACGGCCGTGCCATACCTGTCTTTGCAGGGTCCAGTTCCCGC
CATATCGGAATTGAGCCTTTGATGGATGCCATCACCGAGTACCTCCCTAGTCCAATACAAAGACCTGATGTTGAA
GTATATCTAGGCTCTTCCAAGCACAAGTTGAGTGATGCTCTTCAAACCGAGAAGAATCAGGGCGGGCGTTCCAGT
GTCACATCTGTGGCTTCCATCTTCAAAGTCTTCAACCATCCAAAGGAGGGCGTTCTAAGCTTTGTGCGTGTTTAC
CACGGAACATTAATGCGCAATGCCTCTACTTACAACACAAATCTCATGCTTCAAGAGAGACCGATGGGTATTGTT
CAAGTTTCTGCCTCCAAGACGCAAGAGATAGCGGAACTTTCTGTTGGACAGATTGGAGCTATCAGGGGCTTGAAG
AAGGCGCGCAGCGGGGATACGTTGATTGCCACTACTACTAGTGGAAAGGCTGTGCCTGAAGTGCTACGACAGATG
CGCATCAGGCCTCCTGAGATTCCACCGCCTGTTGCTTTCTTACAAGCTGATGCATACGGTCTTGTTGCTGCAGAG
CAACTGGCGAAGGCCTTGGAAAACGCGTCGAGGGAGGACCCCAGCTTGCGCTGGAATAGAGACGCAAAAACAGAT
CAGTTTACGATACAGGGCATGGGAAAACTCCACCTTGAGGTATCGCTCCATAACATACGACAGAAGCATCAGATT
GATGCCGAATTTGGACAAATCGAGGTTGACTACAAAGAATGCATCACCATTGCCACGGCCCCACAGTATGCAGTA
TTCGATCGTTGCATCGCCAGTAAGACGGGAAAGGCGGCTTGTACCGTTGTGTTGGAGCCCATGGACGCACAGGAG
CTCAATGCGCCAAACAAAATGGGCCTGGAGAGGGACGGGAACTTGTTTCAAGTGGAGATTGCCTCGACAAATGCC
TCCAAGGAGCTAGGTTTTGACGTTGAAGAAGCACGGCAGCAGCTCATAAACGGAGCCATTGCCGGCTTGGCTCGA
GGCCCACGACGAGCGTCGCCCGTGCACAGCTGTCGCGTCAGAGTGACACTTGACACATCACCAGGCGCACTTGAG
AGTCCGAGCGGCGGGCACTTTAGCAGCGCTGCCAGAACAGCTACGCAGGCGGCACTGCGAGAAGCTCATTCCAAA
CAGCAAGTGGTGATACTGGAGCCCATTATGCTGACGCACATCACTTGTCCCGAGACGGTAGCTGGAACAGTGCAA
CACGACATCATGGCGGGAGCTGGTGGGCACGTACTGGAGGTGTCGGACCGGTCGGCAGAATCAACGGGCCAAGAT
GGGATCGACGTGTCAAGCATCTACGCGCCTCGAGATCCCTACGACTCGATAACGTCGCTGAGAGGCAAGAAGTCG
ACAAGCCGCGTCGTTGAGATTGTGGCCAAGGTTCCCTACAAGGAAATGCTGGGCTATGACGAGCACTTGCGAAGC
AAAACGGCAGGACGCCATTCAATGACCATGTCGTTTGACTCGTTTGCCCGCGTCGTTGGACACAGAGAGAAGGGG
CTGTGA
Transcript >OphauB2|2727
ATGTCGCGTTCCCTATACAGCACAGCGGGGTTTGCGTTGAAGCACTTGTTCACTACAACGGAGACCTGCTCTCCG
CAACGAATTGGATTTTCCAGATGCCAAGCGCATAGTCAAGCATGTAATCGATCCTATGACAATAGTCTCGAAAAC
ATTCGCAACATTGGCATTATTGCCCATGTCGACGCTGGGAAAACCACGACGACTGAGCGCATGCTATACTACAGC
GGCGTTACGCAGAGAGTCGGTGATGTCGATTCTGGAAACACCGTCACCGACTTTCTCGAGCTCGAAAGAGCGCGA
GGTATCACAATTCAGTCAGCCGCAATTACTTTTCCATGGCCGCCACTAGCAGAATGCCCCGCGGGAATGCAGCCC
AAGATGATCAACCTCATTGACACTCCTGGCCATCAGGACTTTAGGTTCGAGGTAGACCGCTGCCTCCCCATTCTT
GATGGCGCTGTCTGCATCATTGATTCAGTCAAGGGCGTCGAGGCCCATACGGAGCGAGTGTGGGCGTCTGCCCAT
GACTTTGGCATTCCTCGCATCGTTTACTGCAACAAGCTCGACCGCGATGGCGCCTCGTTCAGAAAATCAGTGCTC
GATATTGGTGCACGCCTCAAGGGCTGGCCTCTAGTCTGTCAAATTCCCTGGTGGGAAAGGGATGTTTTTGTTGGT
GTTATTGACATCATTGACCGAGTAGGATATCGATGGAAATCTATGCAGCAAAAGACGTTTTACGACTCTCAGCAG
CTATCAGACGTGCTCAAGCGCTCAAATGAGTCACTGCTCAATGAAATGCAGGTTGCTAGGCAGCGACTGATTGAG
GGGCTTGCGGAATTCGACGAAGCCGTTATGGACGAGTACTTGGCTGAAAACCCGGATATTCCGACATGTCTCTTG
AAAGATGGAATCCGACGAGCTATTCAAAGTGGCGACGGCCGTGCCATACCTGTCTTTGCAGGGTCCAGTTCCCGC
CATATCGGAATTGAGCCTTTGATGGATGCCATCACCGAGTACCTCCCTAGTCCAATACAAAGACCTGATGTTGAA
GTATATCTAGGCTCTTCCAAGCACAAGTTGAGTGATGCTCTTCAAACCGAGAAGAATCAGGGCGGGCGTTCCAGT
GTCACATCTGTGGCTTCCATCTTCAAAGTCTTCAACCATCCAAAGGAGGGCGTTCTAAGCTTTGTGCGTGTTTAC
CACGGAACATTAATGCGCAATGCCTCTACTTACAACACAAATCTCATGCTTCAAGAGAGACCGATGGGTATTGTT
CAAGTTTCTGCCTCCAAGACGCAAGAGATAGCGGAACTTTCTGTTGGACAGATTGGAGCTATCAGGGGCTTGAAG
AAGGCGCGCAGCGGGGATACGTTGATTGCCACTACTACTAGTGGAAAGGCTGTGCCTGAAGTGCTACGACAGATG
CGCATCAGGCCTCCTGAGATTCCACCGCCTGTTGCTTTCTTACAAGCTGATGCATACGGTCTTGTTGCTGCAGAG
CAACTGGCGAAGGCCTTGGAAAACGCGTCGAGGGAGGACCCCAGCTTGCGCTGGAATAGAGACGCAAAAACAGAT
CAGTTTACGATACAGGGCATGGGAAAACTCCACCTTGAGGTATCGCTCCATAACATACGACAGAAGCATCAGATT
GATGCCGAATTTGGACAAATCGAGGTTGACTACAAAGAATGCATCACCATTGCCACGGCCCCACAGTATGCAGTA
TTCGATCGTTGCATCGCCAGTAAGACGGGAAAGGCGGCTTGTACCGTTGTGTTGGAGCCCATGGACGCACAGGAG
CTCAATGCGCCAAACAAAATGGGCCTGGAGAGGGACGGGAACTTGTTTCAAGTGGAGATTGCCTCGACAAATGCC
TCCAAGGAGCTAGGTTTTGACGTTGAAGAAGCACGGCAGCAGCTCATAAACGGAGCCATTGCCGGCTTGGCTCGA
GGCCCACGACGAGCGTCGCCCGTGCACAGCTGTCGCGTCAGAGTGACACTTGACACATCACCAGGCGCACTTGAG
AGTCCGAGCGGCGGGCACTTTAGCAGCGCTGCCAGAACAGCTACGCAGGCGGCACTGCGAGAAGCTCATTCCAAA
CAGCAAGTGGTGATACTGGAGCCCATTATGCTGACGCACATCACTTGTCCCGAGACGGTAGCTGGAACAGTGCAA
CACGACATCATGGCGGGAGCTGGTGGGCACGTACTGGAGGTGTCGGACCGGTCGGCAGAATCAACGGGCCAAGAT
GGGATCGACGTGTCAAGCATCTACGCGCCTCGAGATCCCTACGACTCGATAACGTCGCTGAGAGGCAAGAAGTCG
ACAAGCCGCGTCGTTGAGATTGTGGCCAAGGTTCCCTACAAGGAAATGCTGGGCTATGACGAGCACTTGCGAAGC
AAAACGGCAGGACGCCATTCAATGACCATGTCGTTTGACTCGTTTGCCCGCGTCGTTGGACACAGAGAGAAGGGG
CTGTGA
Gene >OphauB2|2727
ATGTCGCGTTCCCTATACAGCACAGCGGGGTTTGCGTTGAAGCACTTGTTCACTACAACGGAGACCTGCTCTCCG
CAACGAATTGGATTTTCCAGATGCCAAGCGCATAGTCAAGCATGTAATCGATCCTATGACAATAGTCTCGAAAAC
ATTCGCAACATTGGCATTATTGCCCATGTCGACGCTGTATGACGTTCACTCAGTTCTATCAGCAACTCATAGAAC
TAATTCGCCACAGGGGAAAACCACGACGACTGAGCGCATGCTATACTACAGCGGCGTTACGCAGAGAGTCGGTGG
TATGTGACCATGGCATATATACTTCGACTATGTCGCTACTTTGAGCCGCTAAGCCGGCTTCAAGATGTCGATTCT
GGAAACACCGTCACCGACTTTCTCGAGCTCGAAAGAGCGCGAGGTATCACAATTCAGTCAGCCGCAATTACTTTT
CCATGGCCGCCACTAGCAGAATGCCCCGCGGGAATGCAGCCCAAGATGATCAACCTCATTGACACTCCTGGCCAT
CAGGACTTTAGGTTCGAGGTAGACCGCTGCCTCCCCATTCTTGATGGCGCTGTCTGCATCATTGATTCAGTCAAG
GGCGTCGAGGCCCATACGGAGCGAGTGTGGGCGTCTGCCCATGACTTTGGCATTCCTCGCATCGTTTACTGCAAC
AAGCTCGACCGCGATGGCGCCTCGTTCAGAAAATCAGTGCTCGATATTGGTGCACGCCTCAAGGGCTGGCCTCTA
GTCTGTCAAATTCCCTGGTGGGAAAGGGATGTTTTTGTTGGTGTTATTGACATCATTGACCGAGTAGGATATCGA
TGGAAATCTATGCAGCAAAAGACGTTTTACGACTCTCAGCAGCTATCAGACGTGCTCAAGCGCTCAAATGAGTCA
CTGCTCAATGAAATGCAGGTTGCTAGGCAGCGACTGATTGAGGGGCTTGCGGAATTCGACGAAGCCGTTATGGAC
GAGTACTTGGCTGAAAACCCGGATATTCCGACATGTCTCTTGAAAGATGGAATCCGACGAGCTATTCAAAGTGGC
GACGGCCGTGCCATACCTGTCTTTGCAGGGTCCAGTTCCCGCCATATCGGAATTGAGCCTTTGATGGATGCCATC
ACCGAGTACCTCCCTAGTCCAATACAAAGACCTGATGTTGAAGTATATCTAGGCTCTTCCAAGCACAAGTTGAGT
GATGCTCTTCAAACCGAGAAGAATCAGGGCGGGCGTTCCAGTGTCACATCTGTGGCTTCCATCTTCAAAGTCTTC
AACCATCCAAAGGAGGGCGTTCTAAGCTTTGTGCGTGTTTACCACGGAACATTAATGCGCAATGCCTCTACTTAC
AACACAAATCTCATGCTTCAAGAGAGACCGATGGGTATTGTTCAAGTTTCTGCCTCCAAGACGCAAGAGATAGCG
GAACTTTCTGTTGGACAGATTGGAGCTATCAGGGGCTTGAAGAAGGCGCGCAGCGGGGATACGTTGATTGCCACT
ACTACTAGTGGAAAGGCTGTGCCTGAAGTGCTACGACAGATGCGCATCAGGCCTCCTGAGATTCCACCGCCTGTT
GCTTTCTTACAAGCTGATGCATACGGTCTTGTTGCTGCAGAGCAACTGGCGAAGGCCTTGGAAAACGCGTCGAGG
GAGGACCCCAGCTTGCGCTGGAATAGAGACGCAAAAACAGATCAGTTTACGATACAGGGCATGGGAAAACTCCAC
CTTGAGGTATCGCTCCATAACATACGACAGAAGCATCAGATTGATGCCGAATTTGGACAAATCGAGGTTGACTAC
AAAGAATGCATCACCATTGCCACGGCCCCACAGTATGCAGTATTCGATCGTTGCATCGCCAGTAAGACGGGAAAG
GCGGCTTGTACCGTTGTGTTGGAGCCCATGGACGCACAGGAGCTCAATGCGCCAAACAAAATGGGCCTGGAGAGG
GACGGGAACTTGTTTCAAGTGGAGATTGCCTCGACAAATGCCTCCAAGGAGCTAGGTTTTGACGTTGAAGAAGCA
CGGCAGCAGCTCATAAACGGAGCCATTGCCGGCTTGGCTCGAGGCCCACGACGAGCGTCGCCCGTGCACAGCTGT
CGCGTCAGAGTGACACTTGACACATCACCAGGCGCACTTGAGAGTCCGAGCGGCGGGCACTTTAGCAGCGCTGCC
AGAACAGCTACGCAGGCGGCACTGCGAGAAGCTCATTCCAAACAGCAAGTGGTGATACTGGAGCCCATTATGCTG
ACGCACATCACTTGTCCCGAGACGGTAGCTGGAACAGTGCAACACGACATCATGGCGGGAGCTGGTGGGCACGTA
CTGGAGGTGTCGGACCGGTCGGCAGAATCAACGGGCCAAGATGGGATCGACGTGTCAAGCATCTACGCGCCTCGA
GATCCCTACGACTCGATAACGTCGCTGAGAGGCAAGAAGTCGACAAGCCGCGTCGTTGAGATTGTGGCCAAGGTT
CCCTACAAGGAAATGCTGGGCTATGACGAGCACTTGCGAAGCAAAACGGCAGGACGCCATTCAATGACCATGTCG
TTTGACTCGTTTGCCCGCGTCGTTGGACACAGAGAGAAGGGGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail