Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2723
Gene name
LocationContig_19:103326..106800
Strand-
Gene length (bp)3474
Transcript length (bp)3474
Coding sequence length (bp)3474
Protein length (aa) 1158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13041 PPR_2 PPR repeat family 2.0E-07 255 303
PF13041 PPR_2 PPR repeat family 1.4E-08 854 903
PF13812 PPR_3 Pentatricopeptide repeat domain 8.5E-03 240 302
PF13812 PPR_3 Pentatricopeptide repeat domain 3.2E-03 880 918
PF13812 PPR_3 Pentatricopeptide repeat domain 4.9E-03 930 973
PF01535 PPR PPR repeat 1.1E-03 373 399
PF01535 PPR PPR repeat 7.9E-01 411 431
PF01535 PPR PPR repeat 4.0E-03 858 887
PF01535 PPR PPR repeat 1.1E-03 892 918
PF12854 PPR_1 PPR repeat 1.4E-07 886 918

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10451|PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 735 1153 7.0E-76
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 721 1125 1.0E-24
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 701 1115 3.0E-24
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 718 1124 6.0E-24
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 718 1157 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10451|PPR5_SCHPO Pentatricopeptide repeat-containing protein 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppr5 PE=3 SV=2 735 1153 7.0E-76
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 721 1125 1.0E-24
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 701 1115 3.0E-24
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 718 1124 6.0E-24
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 718 1157 1.0E-23
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 718 1134 2.0E-23
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 718 1116 7.0E-23
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 719 1111 1.0E-22
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 718 1114 2.0E-22
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 718 1095 2.0E-22
sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 718 1117 5.0E-22
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 650 1105 6.0E-22
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 717 1101 1.0E-21
sp|Q9ZUU3|PP190_ARATH Pentatricopeptide repeat-containing protein At2g37230 OS=Arabidopsis thaliana GN=At2g37230 PE=2 SV=1 675 1136 1.0E-21
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 719 1150 2.0E-21
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 795 1131 4.0E-21
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 674 1105 1.0E-20
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 789 1135 4.0E-20
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 715 1115 4.0E-20
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 718 1095 7.0E-20
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 718 1141 8.0E-20
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 726 1108 9.0E-20
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 733 1138 1.0E-19
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 781 1145 1.0E-19
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 718 1136 2.0E-19
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 718 1096 2.0E-19
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protein At4g31850, chloroplastic OS=Arabidopsis thaliana GN=PGR3 PE=1 SV=1 201 1111 3.0E-19
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 812 1131 4.0E-19
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 720 1111 4.0E-19
sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 718 1111 5.0E-19
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 717 1152 1.0E-18
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 812 1135 1.0E-18
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 733 1152 2.0E-18
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 695 1114 2.0E-18
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 718 1152 3.0E-18
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 718 1118 3.0E-18
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 720 1104 3.0E-18
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 721 1141 3.0E-18
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 706 1080 3.0E-18
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 240 1115 7.0E-18
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 706 1068 7.0E-18
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 716 1131 7.0E-18
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 718 1096 1.0E-17
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 718 1135 1.0E-17
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 716 1138 1.0E-17
sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 696 1114 1.0E-17
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 822 1151 3.0E-17
sp|Q9LUR2|PP238_ARATH Putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial OS=Arabidopsis thaliana GN=At3g16710 PE=3 SV=1 702 1031 3.0E-17
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 760 1112 3.0E-17
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 696 1135 3.0E-17
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 718 1157 4.0E-17
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1 776 1123 4.0E-17
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 719 1100 4.0E-17
sp|O81908|PPR2_ARATH Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 796 1136 4.0E-17
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 832 1108 6.0E-17
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 786 1115 8.0E-17
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 718 1108 9.0E-17
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 822 1105 9.0E-17
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 717 1125 1.0E-16
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 718 1069 2.0E-16
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 717 1111 2.0E-16
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 719 1135 2.0E-16
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 785 1117 2.0E-16
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 812 1137 3.0E-16
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 839 1114 3.0E-16
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 726 1145 4.0E-16
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 733 1105 5.0E-16
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 732 1134 6.0E-16
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 721 1115 6.0E-16
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 729 1131 6.0E-16
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 727 1104 8.0E-16
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 718 1068 8.0E-16
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 719 1084 1.0E-15
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 717 1140 1.0E-15
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 720 1152 1.0E-15
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1 699 1152 1.0E-15
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 834 1135 1.0E-15
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 800 1115 1.0E-15
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 839 1095 1.0E-15
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protein At5g42310, mitochondrial OS=Arabidopsis thaliana GN=At5g42310 PE=2 SV=1 719 1135 2.0E-15
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 733 1123 2.0E-15
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 372 970 2.0E-15
sp|Q9FLL3|PP412_ARATH Pentatricopeptide repeat-containing protein At5g41170, mitochondrial OS=Arabidopsis thaliana GN=At5g41170 PE=2 SV=1 699 970 3.0E-15
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 765 1135 3.0E-15
sp|Q0WKZ3|PP105_ARATH Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 851 1096 3.0E-15
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 701 988 4.0E-15
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 702 1037 6.0E-15
sp|Q9SZ20|PP339_ARATH Pentatricopeptide repeat-containing protein At4g26800 OS=Arabidopsis thaliana GN=At4g26800 PE=2 SV=2 815 1106 7.0E-15
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 733 1116 8.0E-15
sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 718 970 8.0E-15
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 840 1095 8.0E-15
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 801 1106 1.0E-14
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 699 1152 2.0E-14
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 838 1105 2.0E-14
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 693 1098 2.0E-14
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 692 1154 2.0E-14
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 719 1067 3.0E-14
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 796 1115 3.0E-14
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 617 1134 4.0E-14
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 643 1081 5.0E-14
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 731 974 5.0E-14
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 838 1150 7.0E-14
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 712 1135 7.0E-14
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 787 1029 8.0E-14
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 798 1141 9.0E-14
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 758 1122 9.0E-14
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 721 1135 1.0E-13
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 837 1132 1.0E-13
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 719 1116 1.0E-13
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 692 1038 2.0E-13
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 713 1115 2.0E-13
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 812 1115 2.0E-13
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 685 1024 2.0E-13
sp|Q9SAA6|PPR34_ARATH Pentatricopeptide repeat-containing protein At1g11710, mitochondrial OS=Arabidopsis thaliana GN=At1g11710 PE=2 SV=1 785 1100 3.0E-13
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 666 1006 3.0E-13
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 840 1145 4.0E-13
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 853 1145 4.0E-13
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 786 1033 4.0E-13
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 717 1136 5.0E-13
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 720 1115 5.0E-13
sp|Q0WLC6|PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 708 970 5.0E-13
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 721 1141 5.0E-13
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 813 1135 6.0E-13
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 715 1145 6.0E-13
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 715 1157 7.0E-13
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 781 1137 7.0E-13
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 349 1107 9.0E-13
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 718 974 9.0E-13
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protein At3g07290, mitochondrial OS=Arabidopsis thaliana GN=At3g07290 PE=2 SV=1 719 1092 1.0E-12
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 820 1111 2.0E-12
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 712 1108 2.0E-12
sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 718 1118 2.0E-12
sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 708 1087 2.0E-12
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 813 1134 3.0E-12
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 726 1136 3.0E-12
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 718 1013 3.0E-12
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 720 971 4.0E-12
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 699 1067 4.0E-12
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 812 1033 4.0E-12
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 677 1099 4.0E-12
sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 718 1062 4.0E-12
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 843 1131 4.0E-12
sp|Q9ASZ8|PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1 732 1152 5.0E-12
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 231 615 5.0E-12
sp|Q9LK58|PP225_ARATH Pentatricopeptide repeat-containing protein At3g13150 OS=Arabidopsis thaliana GN=At3g13150 PE=2 SV=1 710 1060 5.0E-12
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 688 1122 6.0E-12
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 717 1105 6.0E-12
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 854 1134 7.0E-12
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 721 1091 7.0E-12
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 711 973 7.0E-12
sp|Q1PFC5|PP130_ARATH Pentatricopeptide repeat-containing protein At1g77405 OS=Arabidopsis thaliana GN=At1g77405 PE=2 SV=1 861 1068 7.0E-12
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 718 1107 8.0E-12
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 795 1141 8.0E-12
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 781 1141 9.0E-12
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protein At5g61990, mitochondrial OS=Arabidopsis thaliana GN=At5g61990 PE=2 SV=1 740 1140 9.0E-12
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 732 1107 9.0E-12
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 702 1007 9.0E-12
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 718 1060 1.0E-11
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 604 1112 1.0E-11
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1 839 1135 1.0E-11
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 778 1115 1.0E-11
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 839 1145 2.0E-11
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720 OS=Arabidopsis thaliana GN=At1g62720 PE=2 SV=1 718 1105 2.0E-11
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 718 1115 2.0E-11
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 740 1091 2.0E-11
sp|Q9M8M3|PP136_ARATH Pentatricopeptide repeat-containing protein At1g80550, mitochondrial OS=Arabidopsis thaliana GN=At1g80550 PE=2 SV=1 795 1031 2.0E-11
sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 801 1111 2.0E-11
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 795 1069 2.0E-11
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 800 1118 3.0E-11
sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protein At2g41720 OS=Arabidopsis thaliana GN=EMB2654 PE=2 SV=1 719 1102 3.0E-11
sp|Q9LUD6|PP230_ARATH Pentatricopeptide repeat-containing protein At3g14580, mitochondrial OS=Arabidopsis thaliana GN=At3g14580 PE=2 SV=1 810 1007 3.0E-11
sp|Q0WP85|PP150_ARATH Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1 801 1068 3.0E-11
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 718 971 4.0E-11
sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 718 1066 4.0E-11
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 848 1135 4.0E-11
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 689 1135 5.0E-11
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 852 1115 5.0E-11
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 728 1009 5.0E-11
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 851 1134 6.0E-11
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein At1g64583, mitochondrial OS=Arabidopsis thaliana GN=At1g64583 PE=2 SV=1 685 1069 6.0E-11
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 720 1072 6.0E-11
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 784 1082 6.0E-11
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 835 1135 6.0E-11
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 715 1011 6.0E-11
sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 686 1115 6.0E-11
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 852 1115 7.0E-11
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 736 971 8.0E-11
sp|Q9M1D8|PP288_ARATH Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 807 1094 9.0E-11
sp|O04504|PPR27_ARATH Pentatricopeptide repeat-containing protein At1g09820 OS=Arabidopsis thaliana GN=At1g09820 PE=2 SV=1 844 1145 1.0E-10
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 790 1009 1.0E-10
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 708 1069 1.0E-10
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 715 1135 1.0E-10
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 657 1060 1.0E-10
sp|Q9LS25|PP420_ARATH Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 799 1108 1.0E-10
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 826 1115 1.0E-10
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 715 1071 2.0E-10
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 854 1145 2.0E-10
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 688 1100 2.0E-10
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 834 1095 2.0E-10
sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 838 1116 2.0E-10
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 692 1107 2.0E-10
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 832 1135 2.0E-10
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 719 1067 2.0E-10
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 795 1068 2.0E-10
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 812 969 2.0E-10
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 224 596 3.0E-10
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 718 971 3.0E-10
sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protein At2g17670 OS=Arabidopsis thaliana GN=At2g17670 PE=2 SV=1 808 1096 3.0E-10
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein At2g18940, chloroplastic OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1 731 1106 3.0E-10
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 729 1134 3.0E-10
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 839 1125 3.0E-10
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 801 1115 3.0E-10
sp|Q9LVD3|PP434_ARATH Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 812 1118 3.0E-10
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 226 596 4.0E-10
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1 239 626 4.0E-10
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein At1g74850, chloroplastic OS=Arabidopsis thaliana GN=PTAC2 PE=2 SV=1 714 1065 4.0E-10
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 715 1006 4.0E-10
sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 778 1131 4.0E-10
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 836 1134 5.0E-10
sp|Q8GZ63|PP397_ARATH Pentatricopeptide repeat-containing protein At5g25630 OS=Arabidopsis thaliana GN=At5g25630 PE=2 SV=2 798 1141 5.0E-10
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 833 1081 5.0E-10
sp|Q8L6Y3|PP396_ARATH Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 731 917 5.0E-10
sp|Q9LQQ1|PPR20_ARATH Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 721 1028 5.0E-10
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 240 594 6.0E-10
sp|Q9LQQ1|PPR20_ARATH Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 736 992 6.0E-10
sp|O81028|PP171_ARATH Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 717 1114 6.0E-10
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 712 1108 7.0E-10
sp|Q6NKW7|PP164_ARATH Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 717 1043 7.0E-10
sp|Q9SAK0|PP132_ARATH Pentatricopeptide repeat-containing protein At1g79490, mitochondrial OS=Arabidopsis thaliana GN=EMB2217 PE=2 SV=1 793 1007 7.0E-10
sp|Q9FGR7|PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1 801 1115 9.0E-10
sp|Q9M1D8|PP288_ARATH Pentatricopeptide repeat-containing protein At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1 773 1007 9.0E-10
sp|P0C896|PP209_ARATH Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 861 1131 9.0E-10
sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protein At2g16880 OS=Arabidopsis thaliana GN=At2g16880 PE=2 SV=1 684 1135 1.0E-09
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 812 1081 1.0E-09
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 788 1098 1.0E-09
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 701 1079 1.0E-09
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 717 1096 1.0E-09
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 859 1135 1.0E-09
sp|Q9FNG8|PP366_ARATH Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 806 1092 1.0E-09
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 839 1137 1.0E-09
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 838 1137 1.0E-09
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 231 615 2.0E-09
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protein At1g06710, mitochondrial OS=Arabidopsis thaliana GN=At1g06710 PE=3 SV=1 718 1105 2.0E-09
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 839 1101 2.0E-09
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 788 1099 2.0E-09
sp|Q0WP85|PP150_ARATH Pentatricopeptide repeat-containing protein At2g13420, mitochondrial OS=Arabidopsis thaliana GN=At2g13420 PE=2 SV=1 827 1136 2.0E-09
sp|P0C8Q3|PP326_ARATH Pentatricopeptide repeat-containing protein At4g19890 OS=Arabidopsis thaliana GN=At4g19890 PE=2 SV=1 718 1115 2.0E-09
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 839 1140 2.0E-09
sp|Q56XR6|PP421_ARATH Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 719 1007 2.0E-09
sp|Q9FFE3|PP388_ARATH Pentatricopeptide repeat-containing protein At5g16420, mitochondrial OS=Arabidopsis thaliana GN=At5g16420 PE=2 SV=1 735 1096 2.0E-09
sp|Q9FRS4|PPR22_ARATH Pentatricopeptide repeat-containing protein At1g08610 OS=Arabidopsis thaliana GN=At1g08610 PE=2 SV=1 718 1114 2.0E-09
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 240 511 3.0E-09
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 840 1140 3.0E-09
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 937 1135 3.0E-09
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 812 1115 3.0E-09
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 708 991 3.0E-09
sp|O81028|PP171_ARATH Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 715 1031 3.0E-09
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 785 1091 3.0E-09
sp|Q8S8P6|PP180_ARATH Pentatricopeptide repeat-containing protein At2g32630 OS=Arabidopsis thaliana GN=At2g32630 PE=3 SV=1 836 1115 4.0E-09
sp|Q9SSR6|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1 768 970 4.0E-09
sp|Q9SF38|PP222_ARATH Pentatricopeptide repeat-containing protein At3g09650, chloroplastic OS=Arabidopsis thaliana GN=HCF152 PE=2 SV=1 788 966 4.0E-09
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protein At1g62914, mitochondrial OS=Arabidopsis thaliana GN=At1g62914 PE=2 SV=1 836 1134 5.0E-09
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 838 1138 5.0E-09
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protein At3g07290, mitochondrial OS=Arabidopsis thaliana GN=At3g07290 PE=2 SV=1 776 1102 5.0E-09
sp|Q9SAB4|PPR33_ARATH Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana GN=At1g11630 PE=2 SV=1 775 1070 5.0E-09
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 374 1101 6.0E-09
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 718 917 6.0E-09
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 785 1155 6.0E-09
sp|O81028|PP171_ARATH Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 710 1031 6.0E-09
sp|Q84VG6|PP160_ARATH Pentatricopeptide repeat-containing protein At2g17525, mitochondrial OS=Arabidopsis thaliana GN=At2g17525 PE=2 SV=2 781 1091 6.0E-09
sp|Q9LS88|PP250_ARATH Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 840 1091 6.0E-09
sp|A3KPF8|PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 851 1104 6.0E-09
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 689 1047 6.0E-09
sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 769 1013 6.0E-09
sp|Q9LIL5|PP233_ARATH Putative pentatricopeptide repeat-containing protein At3g15200 OS=Arabidopsis thaliana GN=At3g15200 PE=3 SV=1 790 1062 6.0E-09
sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 769 1013 6.0E-09
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana GN=At5g12100 PE=2 SV=1 933 1145 7.0E-09
sp|Q9SH60|PP103_ARATH Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2 277 971 7.0E-09
sp|Q9FKC3|PP424_ARATH Pentatricopeptide repeat-containing protein At5g48730, chloroplastic OS=Arabidopsis thaliana GN=At5g48730 PE=2 SV=2 785 1143 7.0E-09
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 718 917 8.0E-09
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 795 1098 8.0E-09
sp|Q9M8W9|PP211_ARATH Pentatricopeptide repeat-containing protein At3g04130, mitochondrial OS=Arabidopsis thaliana GN=At3g04130 PE=2 SV=2 836 1064 8.0E-09
sp|Q8GWE0|PP314_ARATH Pentatricopeptide repeat-containing protein At4g16390, chloroplastic OS=Arabidopsis thaliana GN=P67 PE=1 SV=3 800 1098 8.0E-09
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 240 600 9.0E-09
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 799 1108 9.0E-09
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 785 1135 9.0E-09
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 562 919 1.0E-08
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 225 519 1.0E-08
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial OS=Arabidopsis thaliana GN=At1g62680 PE=2 SV=2 232 440 1.0E-08
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 220 518 1.0E-08
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=3 SV=2 852 1145 1.0E-08
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 790 1079 1.0E-08
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 661 1052 1.0E-08
sp|Q940A6|PP325_ARATH Pentatricopeptide repeat-containing protein At4g19440, chloroplastic OS=Arabidopsis thaliana GN=At4g19440 PE=2 SV=2 716 1031 1.0E-08
sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 859 1138 1.0E-08
sp|Q5G1S8|PP241_ARATH Pentatricopeptide repeat-containing protein At3g18110, chloroplastic OS=Arabidopsis thaliana GN=EMB1270 PE=2 SV=2 889 1135 1.0E-08
sp|Q9ZUA2|PP141_ARATH Pentatricopeptide repeat-containing protein At2g01740 OS=Arabidopsis thaliana GN=At2g01740 PE=3 SV=1 839 1135 1.0E-08
sp|Q8L6Y3|PP396_ARATH Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 851 1135 1.0E-08
sp|A3KPF8|PP131_ARATH Pentatricopeptide repeat-containing protein At1g79080, chloroplastic OS=Arabidopsis thaliana GN=At1g79080 PE=2 SV=1 786 1138 1.0E-08
sp|Q9SAH2|PP137_ARATH Pentatricopeptide repeat-containing protein At1g80880, mitochondrial OS=Arabidopsis thaliana GN=At1g80880 PE=2 SV=1 718 970 1.0E-08
sp|Q9C9U0|PP118_ARATH Pentatricopeptide repeat-containing protein At1g73710 OS=Arabidopsis thaliana GN=At1g73710 PE=2 SV=1 796 1124 1.0E-08
sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 718 935 2.0E-08
sp|Q9LW84|PP236_ARATH Pentatricopeptide repeat-containing protein At3g16010 OS=Arabidopsis thaliana GN=At3g16010 PE=2 SV=1 823 1137 2.0E-08
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 498 902 2.0E-08
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 726 1009 2.0E-08
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protein At3g61520, mitochondrial OS=Arabidopsis thaliana GN=At3g61520 PE=2 SV=1 799 1154 2.0E-08
sp|Q9LS25|PP420_ARATH Pentatricopeptide repeat-containing protein At5g46580, chloroplastic OS=Arabidopsis thaliana GN=At5g46580 PE=2 SV=1 715 959 2.0E-08
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 832 1135 2.0E-08
sp|Q6NKW7|PP164_ARATH Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 799 1091 2.0E-08
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 226 510 2.0E-08
sp|Q9LFM6|PP375_ARATH Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 854 1100 2.0E-08
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 718 1081 2.0E-08
sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 769 1013 2.0E-08
sp|Q9CAM8|PP100_ARATH Pentatricopeptide repeat-containing protein At1g63150 OS=Arabidopsis thaliana GN=At1g63150 PE=2 SV=1 233 425 3.0E-08
sp|O81908|PPR2_ARATH Pentatricopeptide repeat-containing protein At1g02060, chloroplastic OS=Arabidopsis thaliana GN=At1g02060 PE=2 SV=2 859 1134 3.0E-08
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 733 922 3.0E-08
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 718 1046 3.0E-08
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 220 434 3.0E-08
sp|Q0WLC6|PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana GN=MRL1 PE=2 SV=2 715 1069 3.0E-08
sp|Q9LYT2|PP287_ARATH Pentatricopeptide repeat-containing protein At3g59040 OS=Arabidopsis thaliana GN=At3g59040 PE=2 SV=2 840 1115 3.0E-08
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 239 481 4.0E-08
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 225 528 4.0E-08
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protein At5g28460 OS=Arabidopsis thaliana GN=At5g28460 PE=2 SV=1 799 1154 4.0E-08
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 739 1091 4.0E-08
sp|Q84VG6|PP160_ARATH Pentatricopeptide repeat-containing protein At2g17525, mitochondrial OS=Arabidopsis thaliana GN=At2g17525 PE=2 SV=2 851 1133 4.0E-08
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 838 1145 4.0E-08
sp|Q0WKZ3|PP105_ARATH Pentatricopeptide repeat-containing protein At1g64580 OS=Arabidopsis thaliana GN=At1g64580 PE=2 SV=1 719 1007 5.0E-08
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 849 1141 5.0E-08
sp|O80958|PP194_ARATH Pentatricopeptide repeat-containing protein At2g39230, mitochondrial OS=Arabidopsis thaliana GN=LOJ PE=1 SV=1 717 1081 5.0E-08
sp|Q9LVD3|PP434_ARATH Pentatricopeptide repeat-containing protein At5g57250, mitochondrial OS=Arabidopsis thaliana GN=At5g57250 PE=2 SV=2 647 1084 5.0E-08
sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protein At4g30825, chloroplastic OS=Arabidopsis thaliana GN=At4g30825 PE=2 SV=2 867 1136 5.0E-08
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 240 600 6.0E-08
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 715 1096 6.0E-08
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 687 1012 6.0E-08
sp|Q7X6A5|PPR81_ARATH Pentatricopeptide repeat-containing protein At1g55630 OS=Arabidopsis thaliana GN=At1g55630 PE=2 SV=1 807 1108 6.0E-08
sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 718 917 7.0E-08
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 719 1096 7.0E-08
sp|Q84J46|PP262_ARATH Pentatricopeptide repeat-containing protein At3g29290 OS=Arabidopsis thaliana GN=EMB2076 PE=2 SV=1 840 1069 7.0E-08
sp|Q9C9A2|PP112_ARATH Pentatricopeptide repeat-containing protein At1g71060, mitochondrial OS=Arabidopsis thaliana GN=At1g71060 PE=2 SV=1 852 1135 8.0E-08
sp|Q9FNG8|PP366_ARATH Putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial OS=Arabidopsis thaliana GN=At5g06400 PE=3 SV=1 840 1135 8.0E-08
sp|Q9SZ10|PP338_ARATH Pentatricopeptide repeat-containing protein At4g26680, mitochondrial OS=Arabidopsis thaliana GN=At4g26680 PE=2 SV=1 838 1087 8.0E-08
sp|Q9FND8|PP409_ARATH Pentatricopeptide repeat-containing protein At5g40400 OS=Arabidopsis thaliana GN=At5g40400 PE=2 SV=1 721 1136 8.0E-08
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 708 972 9.0E-08
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protein At2g15630, mitochondrial OS=Arabidopsis thaliana GN=At2g15630 PE=3 SV=1 715 977 9.0E-08
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana GN=At1g06580 PE=2 SV=1 708 917 9.0E-08
sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1 699 1135 9.0E-08
sp|Q8LE47|PPR87_ARATH Pentatricopeptide repeat-containing protein At1g61870, mitochondrial OS=Arabidopsis thaliana GN=PPR336 PE=2 SV=2 839 1070 9.0E-08
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 240 596 1.0E-07
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 721 1043 1.0E-07
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1 719 972 1.0E-07
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 240 422 1.0E-07
sp|Q8L6Y3|PP396_ARATH Pentatricopeptide repeat-containing protein At5g24830 OS=Arabidopsis thaliana GN=At5g24830 PE=2 SV=1 727 1094 1.0E-07
sp|Q9LQQ1|PPR20_ARATH Pentatricopeptide repeat-containing protein At1g07740, mitochondrial OS=Arabidopsis thaliana GN=At1g07740 PE=2 SV=1 823 1107 1.0E-07
sp|P0C896|PP209_ARATH Pentatricopeptide repeat-containing protein At3g02650, mitochondrial OS=Arabidopsis thaliana GN=At3g02650 PE=2 SV=1 778 959 1.0E-07
sp|Q9SCP4|PP279_ARATH Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=3 SV=1 739 989 1.0E-07
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 220 615 2.0E-07
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 784 1095 2.0E-07
sp|Q9LMY5|PPR41_ARATH Putative pentatricopeptide repeat-containing protein At1g13630 OS=Arabidopsis thaliana GN=At1g13630 PE=2 SV=3 696 1102 2.0E-07
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 835 1141 2.0E-07
sp|Q9SV46|PP282_ARATH Pentatricopeptide repeat-containing protein At3g54980, mitochondrial OS=Arabidopsis thaliana GN=At3g54980 PE=2 SV=1 708 979 2.0E-07
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 207 422 2.0E-07
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protein At1g74750 OS=Arabidopsis thaliana GN=At1g74750 PE=2 SV=1 708 970 2.0E-07
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein At1g51965, mitochondrial OS=Arabidopsis thaliana GN=At1g51965 PE=2 SV=1 836 1157 2.0E-07
sp|Q6NKW7|PP164_ARATH Pentatricopeptide repeat-containing protein At2g19280 OS=Arabidopsis thaliana GN=At2g19280 PE=2 SV=2 740 1135 2.0E-07
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 834 1141 2.0E-07
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 226 513 2.0E-07
sp|Q9LZP3|PP293_ARATH Pentatricopeptide repeat-containing protein At3g62470, mitochondrial OS=Arabidopsis thaliana GN=At3g62470 PE=2 SV=1 839 1074 2.0E-07
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 227 615 3.0E-07
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 674 1009 3.0E-07
sp|Q9LSQ2|PP239_ARATH Putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial OS=Arabidopsis thaliana GN=PPR40 PE=3 SV=1 806 918 3.0E-07
sp|P0C7Q9|PPR56_ARATH Pentatricopeptide repeat-containing protein At1g22960, mitochondrial OS=Arabidopsis thaliana GN=At1g22960 PE=2 SV=1 806 1114 3.0E-07
sp|Q0WVV0|PPR31_ARATH Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 837 1131 3.0E-07
sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 691 975 3.0E-07
sp|Q9LUJ4|PP248_ARATH Pentatricopeptide repeat-containing protein At3g22670, mitochondrial OS=Arabidopsis thaliana GN=At3g22670 PE=2 SV=1 785 1074 3.0E-07
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protein At5g14770, mitochondrial OS=Arabidopsis thaliana GN=At5g14770 PE=3 SV=2 812 1141 4.0E-07
sp|Q9FLD8|PP408_ARATH Pentatricopeptide repeat-containing protein At5g39980, chloroplastic OS=Arabidopsis thaliana GN=At5g39980 PE=2 SV=1 854 1140 4.0E-07
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 250 425 6.0E-07
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 702 996 6.0E-07
sp|Q9SXD8|PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1 718 935 7.0E-07
sp|Q0WMY5|PP365_ARATH Pentatricopeptide repeat-containing protein At5g04810, chloroplastic OS=Arabidopsis thaliana GN=PPR4 PE=1 SV=1 401 939 7.0E-07
sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1 712 1074 7.0E-07
sp|Q9LUJ4|PP248_ARATH Pentatricopeptide repeat-containing protein At3g22670, mitochondrial OS=Arabidopsis thaliana GN=At3g22670 PE=2 SV=1 715 918 7.0E-07
sp|Q9LMH5|PPR42_ARATH Putative pentatricopeptide repeat-containing protein At1g13800 OS=Arabidopsis thaliana GN=At1g13800 PE=3 SV=1 795 1028 8.0E-07
sp|Q9SQU6|PP216_ARATH Pentatricopeptide repeat-containing protein At3g06430, chloroplastic OS=Arabidopsis thaliana GN=EMB2750 PE=2 SV=1 723 920 8.0E-07
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial OS=Arabidopsis thaliana GN=At3g22470 PE=2 SV=1 688 918 9.0E-07
sp|Q9FKR3|PP404_ARATH Pentatricopeptide repeat-containing protein At5g38730 OS=Arabidopsis thaliana GN=At5g38730 PE=2 SV=1 825 1066 9.0E-07
sp|Q9LS88|PP250_ARATH Pentatricopeptide repeat-containing protein At3g23020 OS=Arabidopsis thaliana GN=At3g23020 PE=2 SV=1 837 1131 9.0E-07
sp|Q9SAJ5|PP133_ARATH Pentatricopeptide repeat-containing protein At1g79540 OS=Arabidopsis thaliana GN=At1g79540 PE=2 SV=1 720 1123 9.0E-07
sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 705 971 1.0E-06
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protein At5g61400 OS=Arabidopsis thaliana GN=At5g61400 PE=2 SV=1 861 1141 1.0E-06
sp|Q9SSR4|PPR77_ARATH Pentatricopeptide repeat-containing protein At1g52620 OS=Arabidopsis thaliana GN=At1g52620 PE=2 SV=1 731 974 1.0E-06
sp|Q9FVX2|PP129_ARATH Pentatricopeptide repeat-containing protein At1g77360, mitochondrial OS=Arabidopsis thaliana GN=At1g77360 PE=2 SV=2 718 922 1.0E-06
sp|Q8GWE0|PP314_ARATH Pentatricopeptide repeat-containing protein At4g16390, chloroplastic OS=Arabidopsis thaliana GN=P67 PE=1 SV=3 850 1130 1.0E-06
sp|Q0WVV0|PPR31_ARATH Pentatricopeptide repeat-containing protein At1g10910, chloroplastic OS=Arabidopsis thaliana GN=At1g10910 PE=2 SV=1 715 1011 1.0E-06
sp|Q9ZU29|PP139_ARATH Pentatricopeptide repeat-containing protein At2g01390 OS=Arabidopsis thaliana GN=At2g01390/At2g01380 PE=2 SV=2 833 1157 1.0E-06
sp|Q9FX35|PP117_ARATH Pentatricopeptide repeat-containing protein At1g73400, mitochondrial OS=Arabidopsis thaliana GN=At1g73400 PE=2 SV=2 879 1134 1.0E-06
sp|Q9FGR2|PP436_ARATH Pentatricopeptide repeat-containing protein At5g59600 OS=Arabidopsis thaliana GN=PCMP-E1 PE=2 SV=1 784 976 1.0E-06
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 230 420 2.0E-06
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 859 1113 2.0E-06
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 739 974 2.0E-06
sp|Q3EAF8|PP294_ARATH Pentatricopeptide repeat-containing protein At3g62540, mitochondrial OS=Arabidopsis thaliana GN=At3g62540 PE=2 SV=1 839 1074 2.0E-06
sp|Q9LEQ7|PP382_ARATH Pentatricopeptide repeat-containing protein At5g14820, mitochondrial OS=Arabidopsis thaliana GN=At5g14820 PE=2 SV=1 839 1074 2.0E-06
sp|Q9LFM6|PP375_ARATH Pentatricopeptide repeat-containing protein At5g11310, mitochondrial OS=Arabidopsis thaliana GN=At5g11310 PE=2 SV=1 762 1033 2.0E-06
sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 854 1115 2.0E-06
sp|Q9SNB7|PP264_ARATH Pentatricopeptide repeat-containing protein At3g46610 OS=Arabidopsis thaliana GN=At3g46610 PE=2 SV=1 722 975 2.0E-06
sp|Q9LVA2|PP443_ARATH Pentatricopeptide repeat-containing protein At5g62370 OS=Arabidopsis thaliana GN=At5g62370 PE=2 SV=1 824 1038 2.0E-06
sp|Q9FMD3|PP389_ARATH Pentatricopeptide repeat-containing protein At5g16640, mitochondrial OS=Arabidopsis thaliana GN=At5g16640 PE=2 SV=1 638 962 3.0E-06
sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein At4g39620, chloroplastic OS=Arabidopsis thaliana GN=EMB2453 PE=2 SV=1 723 1014 3.0E-06
sp|Q9LFQ4|PP383_ARATH Pentatricopeptide repeat-containing protein At5g15010, mitochondrial OS=Arabidopsis thaliana GN=At5g15010 PE=2 SV=2 714 998 3.0E-06
sp|Q56XR6|PP421_ARATH Pentatricopeptide repeat-containing protein At5g46680 OS=Arabidopsis thaliana GN=At5g46680 PE=2 SV=2 782 1131 4.0E-06
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 813 1134 5.0E-06
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1 250 425 5.0E-06
sp|O81028|PP171_ARATH Pentatricopeptide repeat-containing protein At2g26790, mitochondrial OS=Arabidopsis thaliana GN=At2g26790 PE=3 SV=1 700 1069 5.0E-06
sp|Q9CA54|PP122_ARATH Pentatricopeptide repeat-containing protein At1g74630 OS=Arabidopsis thaliana GN=PCMP-H71 PE=2 SV=1 660 917 5.0E-06
sp|Q9C8T7|PP101_ARATH Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2 718 935 6.0E-06
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protein At1g74900, mitochondrial OS=Arabidopsis thaliana GN=OTP43 PE=2 SV=1 718 997 6.0E-06
sp|Q84J46|PP262_ARATH Pentatricopeptide repeat-containing protein At3g29290 OS=Arabidopsis thaliana GN=EMB2076 PE=2 SV=1 840 1112 6.0E-06
sp|Q9FND8|PP409_ARATH Pentatricopeptide repeat-containing protein At5g40400 OS=Arabidopsis thaliana GN=At5g40400 PE=2 SV=1 837 1131 7.0E-06
sp|Q9LG23|PPR82_ARATH Pentatricopeptide repeat-containing protein At1g55890, mitochondrial OS=Arabidopsis thaliana GN=At1g55890 PE=2 SV=1 801 1060 7.0E-06
sp|Q9CAN6|PPR97_ARATH Pentatricopeptide repeat-containing protein At1g63070, mitochondrial OS=Arabidopsis thaliana GN=At1g63070 PE=2 SV=1 800 971 9.0E-06
sp|P0C8R0|PP416_ARATH Putative pentatricopeptide repeat-containing protein At5g43820 OS=Arabidopsis thaliana GN=At5g43820 PE=3 SV=1 740 1065 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2723
MPTIYSSLYTNFIRQGSTFAKSISTHGYAQSVVAATHPHVLNSQNRPLFGRRHTSRLGRLSALQLNSAFHTDRTG
TSLSSDQRHGYLHGGLDAYYEALQKKEATGELDKEWTQYEFPKRLEWKPNSSTVLASSEAIAFGEDVASAQDEMS
PVFTTEEAAALAHIDAALEKEIEYRKSHEVTENVPADTSVILASRSAPLTPTSARSQRTVTPPVDSQSQSYADHL
SMLSAASRYAEIPAVFEAMLATGVKPIATSYNALLMAAIHLPTKKIEVVSKALDVYADMVRRRVSPNSTTFNILV
ELLASRSLEVSEMKKWLETKRSRFGGMDEPGRFMFASHELEHAILCEDDRLDLAIKLFDAATDADAACYSAQTYH
QLISACAKAGRVSDMMRLYEHMESHMTVPFAATFPTMIAAFAKRGDLVSAIECYNEYRNLAVANDGGQATLQDRL
DGQVYAAVINAYVVSDKSEGAMKFFTKVVAEYGAKFANMEDDIIGGGFVKGFAARGIYREALEWAKSVSPEARAQ
ASARIAMLAADSGDKEAAYEAFESLEANIDMQTAPTTALLAMSIREGDVAAATKCWQALMDPQVRADATFIEPTA
MYAVALIGSGQVAEGLAQSEVMFERIRACEAKARPQLAEEIDEGVDFIYRFMESRGLGDAREMMSQLLSMPRQTL
MASPYLSTRTVSSYEDAFDPYAHKTDFKGSSLIADDLERKGCRLNEALDRFRNIRRSGRHPRYITYSKLISAAAR
ENKMELCDEVLAMARNDVPLLPQYAVVRYGWSSILDAMVGACLNMGNRGRAEQYHQELLDMGAAPSANTFGLYIT
SLKDSAKMFDEASEAVRIFHRAKAEGVEPSSFLYNALIGKLGKARRIDDCLFYFAEMRALGIKPTSVTYGTIVNA
LCRVSDEKFAEELFDEMEGMPNYKARPAPYNSMMQFFLTTKRDRSKVLDYFERMKSRGIAPTSHTFKLLIDTYAT
LEPVEMTAAQGVLDMMGSSGQRPEAVHYASLIHARGCVLHDLQGARELFNSIIDEGRVAVNASLFQALFEAMVAN
HRVEDTEQLLAQMQERGVELTPYIANTLIHGWAARKKMDKAQGIYDAVARDRREPSTYEAMTRAFLSVDLRERAK
GTVGEMLTRGYPGAVVNKVLELLGGGQEVRMA*
Coding >OphauB2|2723
ATGCCCACCATTTACTCTTCACTCTACACGAATTTCATCCGTCAAGGATCAACATTCGCCAAATCCATCTCCACC
CACGGCTACGCGCAGTCGGTTGTAGCTGCTACCCACCCCCACGTTCTCAACTCGCAGAACCGCCCCCTTTTCGGT
CGTCGACACACTAGCAGGCTAGGACGTCTTTCTGCCCTTCAGCTCAACTCGGCCTTTCACACAGACCGTACGGGT
ACTAGTCTCTCGTCTGACCAGCGCCATGGATATCTTCACGGAGGCCTAGATGCCTACTATGAGGCTCTTCAGAAG
AAGGAGGCTACTGGTGAGCTTGACAAAGAATGGACACAGTATGAGTTTCCCAAACGGTTGGAATGGAAACCCAAC
TCATCCACTGTCCTCGCCAGCAGCGAGGCCATTGCTTTTGGCGAGGATGTCGCCTCAGCTCAAGATGAGATGTCA
CCGGTCTTTACTACTGAAGAGGCCGCTGCACTCGCTCATATTGACGCTGCTTTGGAAAAAGAGATTGAGTATAGA
AAGTCTCATGAGGTTACCGAAAATGTACCAGCAGACACTTCTGTCATCTTGGCTTCCCGTTCAGCTCCTCTGACG
CCCACGTCTGCACGGTCACAGCGGACCGTGACACCTCCTGTGGATAGCCAGTCACAATCATATGCCGACCACCTG
TCCATGCTGTCGGCTGCGTCTCGCTATGCAGAAATTCCAGCCGTATTCGAAGCCATGCTCGCTACAGGAGTCAAG
CCCATAGCGACTTCTTACAATGCTCTTCTGATGGCTGCTATTCATCTTCCGACCAAGAAAATTGAAGTCGTCTCT
AAGGCCCTAGACGTCTATGCCGACATGGTGAGGCGAAGAGTCTCACCCAACAGCACGACATTCAATATTCTCGTG
GAACTCCTTGCCTCGCGATCCCTTGAAGTCTCAGAGATGAAAAAATGGCTAGAAACCAAGCGTTCCAGATTCGGC
GGCATGGATGAGCCTGGCAGGTTCATGTTTGCCTCTCACGAGCTCGAGCACGCCATCTTGTGTGAAGACGATAGG
CTTGACCTGGCCATCAAACTCTTCGATGCAGCAACTGACGCTGATGCTGCTTGTTATTCTGCCCAGACATACCAC
CAACTCATTTCTGCGTGTGCCAAGGCTGGCCGTGTTTCGGACATGATGCGTCTGTACGAGCACATGGAATCTCAT
ATGACGGTTCCCTTTGCGGCAACCTTTCCCACAATGATTGCTGCATTCGCGAAGCGGGGCGATCTCGTTAGTGCT
ATCGAGTGCTATAATGAGTATCGTAATTTGGCTGTAGCCAACGATGGAGGACAGGCAACTCTACAAGATCGCCTT
GATGGCCAAGTCTACGCAGCGGTAATAAACGCATATGTTGTATCCGACAAGTCCGAGGGGGCCATGAAGTTTTTC
ACCAAAGTTGTTGCCGAGTATGGTGCAAAATTTGCCAACATGGAAGACGACATAATAGGTGGGGGCTTCGTCAAG
GGTTTTGCGGCACGGGGCATTTACCGCGAGGCCCTTGAGTGGGCAAAGTCAGTGTCACCCGAGGCTCGAGCTCAG
GCCAGTGCCAGAATCGCCATGCTCGCTGCGGACAGTGGTGACAAAGAGGCAGCCTATGAAGCCTTTGAGTCGCTC
GAGGCAAACATAGATATGCAAACTGCCCCTACAACAGCTTTGCTCGCCATGAGCATTCGCGAGGGCGATGTTGCC
GCAGCTACCAAGTGCTGGCAGGCGCTCATGGATCCACAAGTACGAGCAGACGCAACCTTTATAGAACCCACGGCC
ATGTACGCTGTTGCGCTCATTGGCTCTGGCCAAGTTGCCGAGGGTCTGGCTCAGTCAGAAGTGATGTTTGAGCGG
ATTCGGGCTTGTGAGGCCAAGGCGCGGCCTCAGTTGGCCGAGGAGATTGATGAAGGTGTCGACTTTATTTATCGC
TTTATGGAAAGTCGCGGGCTTGGCGATGCACGAGAAATGATGTCGCAGTTGTTGAGCATGCCTCGTCAGACGCTC
ATGGCATCACCTTATCTCTCAACTCGTACGGTTTCCAGCTATGAGGATGCTTTTGATCCTTATGCTCACAAGACC
GACTTCAAGGGATCTTCGCTGATTGCGGATGATCTTGAGCGCAAAGGATGTCGATTGAACGAGGCGTTGGATCGC
TTCCGCAACATTCGGCGTTCGGGGCGGCATCCGCGCTACATTACGTACTCGAAGCTCATATCGGCTGCAGCTCGC
GAGAACAAGATGGAGCTTTGTGATGAGGTGCTTGCCATGGCACGGAATGACGTTCCTCTGCTGCCACAGTATGCC
GTGGTTCGCTATGGCTGGTCGTCGATTCTCGACGCCATGGTTGGTGCCTGTCTGAATATGGGGAACCGCGGGCGC
GCTGAGCAATATCACCAAGAGCTGCTTGACATGGGGGCGGCTCCATCTGCAAACACATTTGGACTTTATATCACG
TCTCTCAAGGACTCGGCCAAGATGTTTGACGAGGCATCTGAGGCGGTGCGCATTTTCCACCGTGCCAAAGCTGAA
GGAGTAGAGCCCAGCTCCTTCTTGTACAATGCTCTGATTGGCAAGCTCGGTAAAGCACGGCGTATCGATGACTGT
TTGTTTTACTTTGCTGAAATGAGGGCTCTTGGTATCAAGCCGACGTCAGTCACATATGGCACCATTGTCAATGCT
CTTTGCCGAGTCAGCGACGAAAAGTTTGCCGAGGAGCTGTTTGATGAGATGGAAGGCATGCCCAACTACAAGGCT
CGGCCGGCTCCCTACAACAGCATGATGCAGTTCTTCTTGACGACTAAGCGCGACCGGAGCAAGGTGCTTGACTAC
TTTGAGCGTATGAAGAGTCGGGGTATCGCCCCAACGTCGCACACTTTCAAACTTTTGATTGATACATATGCGACG
CTGGAGCCGGTTGAAATGACGGCGGCACAGGGGGTTCTTGACATGATGGGTTCCTCGGGCCAGCGGCCAGAAGCG
GTTCATTACGCCTCACTCATCCATGCTCGGGGCTGTGTCTTGCACGACTTGCAAGGGGCGCGAGAGCTGTTTAAT
AGCATCATTGACGAGGGGCGCGTGGCTGTTAATGCCAGCCTTTTCCAGGCCCTTTTTGAGGCCATGGTGGCCAAC
CATCGGGTCGAGGATACTGAGCAACTGCTAGCACAGATGCAAGAAAGAGGAGTAGAGTTGACGCCTTATATTGCA
AACACGTTGATTCACGGATGGGCGGCACGGAAGAAGATGGACAAGGCGCAAGGCATCTATGATGCCGTGGCACGG
GACAGGCGTGAGCCTAGCACATACGAGGCCATGACTAGGGCCTTTCTATCAGTCGACTTGCGGGAGCGAGCCAAG
GGAACGGTTGGCGAAATGCTGACGCGCGGGTACCCTGGTGCTGTGGTCAACAAGGTGCTGGAGCTTCTAGGGGGC
GGCCAAGAAGTTCGGATGGCCTAG
Transcript >OphauB2|2723
ATGCCCACCATTTACTCTTCACTCTACACGAATTTCATCCGTCAAGGATCAACATTCGCCAAATCCATCTCCACC
CACGGCTACGCGCAGTCGGTTGTAGCTGCTACCCACCCCCACGTTCTCAACTCGCAGAACCGCCCCCTTTTCGGT
CGTCGACACACTAGCAGGCTAGGACGTCTTTCTGCCCTTCAGCTCAACTCGGCCTTTCACACAGACCGTACGGGT
ACTAGTCTCTCGTCTGACCAGCGCCATGGATATCTTCACGGAGGCCTAGATGCCTACTATGAGGCTCTTCAGAAG
AAGGAGGCTACTGGTGAGCTTGACAAAGAATGGACACAGTATGAGTTTCCCAAACGGTTGGAATGGAAACCCAAC
TCATCCACTGTCCTCGCCAGCAGCGAGGCCATTGCTTTTGGCGAGGATGTCGCCTCAGCTCAAGATGAGATGTCA
CCGGTCTTTACTACTGAAGAGGCCGCTGCACTCGCTCATATTGACGCTGCTTTGGAAAAAGAGATTGAGTATAGA
AAGTCTCATGAGGTTACCGAAAATGTACCAGCAGACACTTCTGTCATCTTGGCTTCCCGTTCAGCTCCTCTGACG
CCCACGTCTGCACGGTCACAGCGGACCGTGACACCTCCTGTGGATAGCCAGTCACAATCATATGCCGACCACCTG
TCCATGCTGTCGGCTGCGTCTCGCTATGCAGAAATTCCAGCCGTATTCGAAGCCATGCTCGCTACAGGAGTCAAG
CCCATAGCGACTTCTTACAATGCTCTTCTGATGGCTGCTATTCATCTTCCGACCAAGAAAATTGAAGTCGTCTCT
AAGGCCCTAGACGTCTATGCCGACATGGTGAGGCGAAGAGTCTCACCCAACAGCACGACATTCAATATTCTCGTG
GAACTCCTTGCCTCGCGATCCCTTGAAGTCTCAGAGATGAAAAAATGGCTAGAAACCAAGCGTTCCAGATTCGGC
GGCATGGATGAGCCTGGCAGGTTCATGTTTGCCTCTCACGAGCTCGAGCACGCCATCTTGTGTGAAGACGATAGG
CTTGACCTGGCCATCAAACTCTTCGATGCAGCAACTGACGCTGATGCTGCTTGTTATTCTGCCCAGACATACCAC
CAACTCATTTCTGCGTGTGCCAAGGCTGGCCGTGTTTCGGACATGATGCGTCTGTACGAGCACATGGAATCTCAT
ATGACGGTTCCCTTTGCGGCAACCTTTCCCACAATGATTGCTGCATTCGCGAAGCGGGGCGATCTCGTTAGTGCT
ATCGAGTGCTATAATGAGTATCGTAATTTGGCTGTAGCCAACGATGGAGGACAGGCAACTCTACAAGATCGCCTT
GATGGCCAAGTCTACGCAGCGGTAATAAACGCATATGTTGTATCCGACAAGTCCGAGGGGGCCATGAAGTTTTTC
ACCAAAGTTGTTGCCGAGTATGGTGCAAAATTTGCCAACATGGAAGACGACATAATAGGTGGGGGCTTCGTCAAG
GGTTTTGCGGCACGGGGCATTTACCGCGAGGCCCTTGAGTGGGCAAAGTCAGTGTCACCCGAGGCTCGAGCTCAG
GCCAGTGCCAGAATCGCCATGCTCGCTGCGGACAGTGGTGACAAAGAGGCAGCCTATGAAGCCTTTGAGTCGCTC
GAGGCAAACATAGATATGCAAACTGCCCCTACAACAGCTTTGCTCGCCATGAGCATTCGCGAGGGCGATGTTGCC
GCAGCTACCAAGTGCTGGCAGGCGCTCATGGATCCACAAGTACGAGCAGACGCAACCTTTATAGAACCCACGGCC
ATGTACGCTGTTGCGCTCATTGGCTCTGGCCAAGTTGCCGAGGGTCTGGCTCAGTCAGAAGTGATGTTTGAGCGG
ATTCGGGCTTGTGAGGCCAAGGCGCGGCCTCAGTTGGCCGAGGAGATTGATGAAGGTGTCGACTTTATTTATCGC
TTTATGGAAAGTCGCGGGCTTGGCGATGCACGAGAAATGATGTCGCAGTTGTTGAGCATGCCTCGTCAGACGCTC
ATGGCATCACCTTATCTCTCAACTCGTACGGTTTCCAGCTATGAGGATGCTTTTGATCCTTATGCTCACAAGACC
GACTTCAAGGGATCTTCGCTGATTGCGGATGATCTTGAGCGCAAAGGATGTCGATTGAACGAGGCGTTGGATCGC
TTCCGCAACATTCGGCGTTCGGGGCGGCATCCGCGCTACATTACGTACTCGAAGCTCATATCGGCTGCAGCTCGC
GAGAACAAGATGGAGCTTTGTGATGAGGTGCTTGCCATGGCACGGAATGACGTTCCTCTGCTGCCACAGTATGCC
GTGGTTCGCTATGGCTGGTCGTCGATTCTCGACGCCATGGTTGGTGCCTGTCTGAATATGGGGAACCGCGGGCGC
GCTGAGCAATATCACCAAGAGCTGCTTGACATGGGGGCGGCTCCATCTGCAAACACATTTGGACTTTATATCACG
TCTCTCAAGGACTCGGCCAAGATGTTTGACGAGGCATCTGAGGCGGTGCGCATTTTCCACCGTGCCAAAGCTGAA
GGAGTAGAGCCCAGCTCCTTCTTGTACAATGCTCTGATTGGCAAGCTCGGTAAAGCACGGCGTATCGATGACTGT
TTGTTTTACTTTGCTGAAATGAGGGCTCTTGGTATCAAGCCGACGTCAGTCACATATGGCACCATTGTCAATGCT
CTTTGCCGAGTCAGCGACGAAAAGTTTGCCGAGGAGCTGTTTGATGAGATGGAAGGCATGCCCAACTACAAGGCT
CGGCCGGCTCCCTACAACAGCATGATGCAGTTCTTCTTGACGACTAAGCGCGACCGGAGCAAGGTGCTTGACTAC
TTTGAGCGTATGAAGAGTCGGGGTATCGCCCCAACGTCGCACACTTTCAAACTTTTGATTGATACATATGCGACG
CTGGAGCCGGTTGAAATGACGGCGGCACAGGGGGTTCTTGACATGATGGGTTCCTCGGGCCAGCGGCCAGAAGCG
GTTCATTACGCCTCACTCATCCATGCTCGGGGCTGTGTCTTGCACGACTTGCAAGGGGCGCGAGAGCTGTTTAAT
AGCATCATTGACGAGGGGCGCGTGGCTGTTAATGCCAGCCTTTTCCAGGCCCTTTTTGAGGCCATGGTGGCCAAC
CATCGGGTCGAGGATACTGAGCAACTGCTAGCACAGATGCAAGAAAGAGGAGTAGAGTTGACGCCTTATATTGCA
AACACGTTGATTCACGGATGGGCGGCACGGAAGAAGATGGACAAGGCGCAAGGCATCTATGATGCCGTGGCACGG
GACAGGCGTGAGCCTAGCACATACGAGGCCATGACTAGGGCCTTTCTATCAGTCGACTTGCGGGAGCGAGCCAAG
GGAACGGTTGGCGAAATGCTGACGCGCGGGTACCCTGGTGCTGTGGTCAACAAGGTGCTGGAGCTTCTAGGGGGC
GGCCAAGAAGTTCGGATGGCCTAG
Gene >OphauB2|2723
ATGCCCACCATTTACTCTTCACTCTACACGAATTTCATCCGTCAAGGATCAACATTCGCCAAATCCATCTCCACC
CACGGCTACGCGCAGTCGGTTGTAGCTGCTACCCACCCCCACGTTCTCAACTCGCAGAACCGCCCCCTTTTCGGT
CGTCGACACACTAGCAGGCTAGGACGTCTTTCTGCCCTTCAGCTCAACTCGGCCTTTCACACAGACCGTACGGGT
ACTAGTCTCTCGTCTGACCAGCGCCATGGATATCTTCACGGAGGCCTAGATGCCTACTATGAGGCTCTTCAGAAG
AAGGAGGCTACTGGTGAGCTTGACAAAGAATGGACACAGTATGAGTTTCCCAAACGGTTGGAATGGAAACCCAAC
TCATCCACTGTCCTCGCCAGCAGCGAGGCCATTGCTTTTGGCGAGGATGTCGCCTCAGCTCAAGATGAGATGTCA
CCGGTCTTTACTACTGAAGAGGCCGCTGCACTCGCTCATATTGACGCTGCTTTGGAAAAAGAGATTGAGTATAGA
AAGTCTCATGAGGTTACCGAAAATGTACCAGCAGACACTTCTGTCATCTTGGCTTCCCGTTCAGCTCCTCTGACG
CCCACGTCTGCACGGTCACAGCGGACCGTGACACCTCCTGTGGATAGCCAGTCACAATCATATGCCGACCACCTG
TCCATGCTGTCGGCTGCGTCTCGCTATGCAGAAATTCCAGCCGTATTCGAAGCCATGCTCGCTACAGGAGTCAAG
CCCATAGCGACTTCTTACAATGCTCTTCTGATGGCTGCTATTCATCTTCCGACCAAGAAAATTGAAGTCGTCTCT
AAGGCCCTAGACGTCTATGCCGACATGGTGAGGCGAAGAGTCTCACCCAACAGCACGACATTCAATATTCTCGTG
GAACTCCTTGCCTCGCGATCCCTTGAAGTCTCAGAGATGAAAAAATGGCTAGAAACCAAGCGTTCCAGATTCGGC
GGCATGGATGAGCCTGGCAGGTTCATGTTTGCCTCTCACGAGCTCGAGCACGCCATCTTGTGTGAAGACGATAGG
CTTGACCTGGCCATCAAACTCTTCGATGCAGCAACTGACGCTGATGCTGCTTGTTATTCTGCCCAGACATACCAC
CAACTCATTTCTGCGTGTGCCAAGGCTGGCCGTGTTTCGGACATGATGCGTCTGTACGAGCACATGGAATCTCAT
ATGACGGTTCCCTTTGCGGCAACCTTTCCCACAATGATTGCTGCATTCGCGAAGCGGGGCGATCTCGTTAGTGCT
ATCGAGTGCTATAATGAGTATCGTAATTTGGCTGTAGCCAACGATGGAGGACAGGCAACTCTACAAGATCGCCTT
GATGGCCAAGTCTACGCAGCGGTAATAAACGCATATGTTGTATCCGACAAGTCCGAGGGGGCCATGAAGTTTTTC
ACCAAAGTTGTTGCCGAGTATGGTGCAAAATTTGCCAACATGGAAGACGACATAATAGGTGGGGGCTTCGTCAAG
GGTTTTGCGGCACGGGGCATTTACCGCGAGGCCCTTGAGTGGGCAAAGTCAGTGTCACCCGAGGCTCGAGCTCAG
GCCAGTGCCAGAATCGCCATGCTCGCTGCGGACAGTGGTGACAAAGAGGCAGCCTATGAAGCCTTTGAGTCGCTC
GAGGCAAACATAGATATGCAAACTGCCCCTACAACAGCTTTGCTCGCCATGAGCATTCGCGAGGGCGATGTTGCC
GCAGCTACCAAGTGCTGGCAGGCGCTCATGGATCCACAAGTACGAGCAGACGCAACCTTTATAGAACCCACGGCC
ATGTACGCTGTTGCGCTCATTGGCTCTGGCCAAGTTGCCGAGGGTCTGGCTCAGTCAGAAGTGATGTTTGAGCGG
ATTCGGGCTTGTGAGGCCAAGGCGCGGCCTCAGTTGGCCGAGGAGATTGATGAAGGTGTCGACTTTATTTATCGC
TTTATGGAAAGTCGCGGGCTTGGCGATGCACGAGAAATGATGTCGCAGTTGTTGAGCATGCCTCGTCAGACGCTC
ATGGCATCACCTTATCTCTCAACTCGTACGGTTTCCAGCTATGAGGATGCTTTTGATCCTTATGCTCACAAGACC
GACTTCAAGGGATCTTCGCTGATTGCGGATGATCTTGAGCGCAAAGGATGTCGATTGAACGAGGCGTTGGATCGC
TTCCGCAACATTCGGCGTTCGGGGCGGCATCCGCGCTACATTACGTACTCGAAGCTCATATCGGCTGCAGCTCGC
GAGAACAAGATGGAGCTTTGTGATGAGGTGCTTGCCATGGCACGGAATGACGTTCCTCTGCTGCCACAGTATGCC
GTGGTTCGCTATGGCTGGTCGTCGATTCTCGACGCCATGGTTGGTGCCTGTCTGAATATGGGGAACCGCGGGCGC
GCTGAGCAATATCACCAAGAGCTGCTTGACATGGGGGCGGCTCCATCTGCAAACACATTTGGACTTTATATCACG
TCTCTCAAGGACTCGGCCAAGATGTTTGACGAGGCATCTGAGGCGGTGCGCATTTTCCACCGTGCCAAAGCTGAA
GGAGTAGAGCCCAGCTCCTTCTTGTACAATGCTCTGATTGGCAAGCTCGGTAAAGCACGGCGTATCGATGACTGT
TTGTTTTACTTTGCTGAAATGAGGGCTCTTGGTATCAAGCCGACGTCAGTCACATATGGCACCATTGTCAATGCT
CTTTGCCGAGTCAGCGACGAAAAGTTTGCCGAGGAGCTGTTTGATGAGATGGAAGGCATGCCCAACTACAAGGCT
CGGCCGGCTCCCTACAACAGCATGATGCAGTTCTTCTTGACGACTAAGCGCGACCGGAGCAAGGTGCTTGACTAC
TTTGAGCGTATGAAGAGTCGGGGTATCGCCCCAACGTCGCACACTTTCAAACTTTTGATTGATACATATGCGACG
CTGGAGCCGGTTGAAATGACGGCGGCACAGGGGGTTCTTGACATGATGGGTTCCTCGGGCCAGCGGCCAGAAGCG
GTTCATTACGCCTCACTCATCCATGCTCGGGGCTGTGTCTTGCACGACTTGCAAGGGGCGCGAGAGCTGTTTAAT
AGCATCATTGACGAGGGGCGCGTGGCTGTTAATGCCAGCCTTTTCCAGGCCCTTTTTGAGGCCATGGTGGCCAAC
CATCGGGTCGAGGATACTGAGCAACTGCTAGCACAGATGCAAGAAAGAGGAGTAGAGTTGACGCCTTATATTGCA
AACACGTTGATTCACGGATGGGCGGCACGGAAGAAGATGGACAAGGCGCAAGGCATCTATGATGCCGTGGCACGG
GACAGGCGTGAGCCTAGCACATACGAGGCCATGACTAGGGCCTTTCTATCAGTCGACTTGCGGGAGCGAGCCAAG
GGAACGGTTGGCGAAATGCTGACGCGCGGGTACCCTGGTGCTGTGGTCAACAAGGTGCTGGAGCTTCTAGGGGGC
GGCCAAGAAGTTCGGATGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail