Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2719
Gene name
LocationContig_19:95455..96412
Strand-
Gene length (bp)957
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.6E-04 118 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ47|ESF2_GIBZE Pre-rRNA-processing protein ESF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ESF2 PE=3 SV=1 1 318 1.0E-120
sp|Q2GZQ4|ESF2_CHAGB Pre-rRNA-processing protein ESF2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ESF2 PE=3 SV=2 1 318 8.0E-113
sp|Q7S8W7|ESF2_NEUCR Pre-rRNA-processing protein esf-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=esf-2 PE=3 SV=1 5 318 9.0E-108
sp|Q0UM32|ESF2_PHANO Pre-rRNA-processing protein ESF2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ESF2 PE=3 SV=1 1 318 3.0E-66
sp|A3LVD5|ESF2_PICST Pre-rRNA-processing protein ESF2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ESF2 PE=3 SV=2 45 318 3.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ47|ESF2_GIBZE Pre-rRNA-processing protein ESF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ESF2 PE=3 SV=1 1 318 1.0E-120
sp|Q2GZQ4|ESF2_CHAGB Pre-rRNA-processing protein ESF2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ESF2 PE=3 SV=2 1 318 8.0E-113
sp|Q7S8W7|ESF2_NEUCR Pre-rRNA-processing protein esf-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=esf-2 PE=3 SV=1 5 318 9.0E-108
sp|Q0UM32|ESF2_PHANO Pre-rRNA-processing protein ESF2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ESF2 PE=3 SV=1 1 318 3.0E-66
sp|A3LVD5|ESF2_PICST Pre-rRNA-processing protein ESF2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ESF2 PE=3 SV=2 45 318 3.0E-63
sp|O74362|ESF2_SCHPO Pre-rRNA-processing protein esf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=esf2 PE=1 SV=1 98 269 3.0E-62
sp|Q59YL9|ESF2_CANAL Pre-rRNA-processing protein ESF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ESF2 PE=3 SV=2 91 318 2.0E-60
sp|Q6BSS5|ESF2_DEBHA Pre-rRNA-processing protein ESF2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ESF2 PE=3 SV=2 98 277 3.0E-58
sp|Q75DA3|ESF2_ASHGO Pre-rRNA-processing protein ESF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ESF2 PE=3 SV=1 37 268 8.0E-58
sp|Q6FWS2|ESF2_CANGA Pre-rRNA-processing protein ESF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ESF2 PE=3 SV=1 71 265 6.0E-56
sp|P53743|ESF2_YEAST Pre-rRNA-processing protein ESF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESF2 PE=1 SV=1 115 293 4.0E-53
sp|Q6CSP8|ESF2_KLULA Pre-rRNA-processing protein ESF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ESF2 PE=3 SV=1 114 293 5.0E-53
sp|Q6CFT1|ESF2_YARLI Pre-rRNA-processing protein ESF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ESF2 PE=3 SV=1 97 257 8.0E-51
sp|Q2UB17|ESF2_ASPOR Pre-rRNA-processing protein esf2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=esf2 PE=3 SV=1 1 318 9.0E-51
sp|Q4WZJ0|ESF2_ASPFU Pre-rRNA-processing protein esf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=esf2 PE=3 SV=2 114 263 6.0E-48
sp|Q5AWM5|ESF2_EMENI Pre-rRNA-processing protein esf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=esf2 PE=3 SV=1 1 318 1.0E-46
sp|A1C807|ESF2_ASPCL Pre-rRNA-processing protein esf2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=esf2 PE=3 SV=1 1 270 5.0E-46
sp|A2QJZ4|ESF2_ASPNC Pre-rRNA-processing protein esf2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=esf2 PE=3 SV=1 88 263 3.0E-45
sp|Q1DJR2|ESF2_COCIM Pre-rRNA-processing protein ESF2 OS=Coccidioides immitis (strain RS) GN=ESF2 PE=3 SV=1 115 262 2.0E-39
sp|P0CL96|ESF2_CRYNJ Pre-rRNA-processing protein ESF2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ESF2 PE=3 SV=1 116 259 4.0E-34
sp|P0CL97|ESF2_CRYNB Pre-rRNA-processing protein ESF2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ESF2 PE=3 SV=1 116 259 4.0E-34
sp|Q4KLM5|ABT1_RAT Activator of basal transcription 1 OS=Rattus norvegicus GN=Abt1 PE=1 SV=1 116 257 3.0E-26
sp|Q9QYL7|ABT1_MOUSE Activator of basal transcription 1 OS=Mus musculus GN=Abt1 PE=2 SV=1 116 259 5.0E-25
sp|Q54BL2|EFS2_DICDI Putative pre-rRNA-processing protein esf2 OS=Dictyostelium discoideum GN=esf2 PE=3 SV=1 116 257 3.0E-24
sp|Q5R9Y3|ABT1_PONAB Activator of basal transcription 1 OS=Pongo abelii GN=ABT1 PE=2 SV=1 116 257 2.0E-23
sp|Q9ULW3|ABT1_HUMAN Activator of basal transcription 1 OS=Homo sapiens GN=ABT1 PE=1 SV=1 116 257 2.0E-23
sp|Q148M8|ABT1_BOVIN Activator of basal transcription 1 OS=Bos taurus GN=ABT1 PE=2 SV=1 116 257 7.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2719
MAPQIRNNFLDASESDDDANDGYESPDELAKGGGSVKRRKLDSDDNNGDEDGEDEFNDVDLAETNNAIGDASETS
EGQIPKAIKPKHEREAKLSSISKPLSKKNLVDTEKAIKKSGVVFLSRVPPFMRPNKLRSLLQPYGVINRIFLAPE
DPALHSRRVRAGGNKRRSFTEGWVEFVKKKEAKAACELLNARIVGGKKSSYYHDDIWNLLYLKGFKWHHLTEQIT
TENAERTSRMRAEISRATKENKEFVKNVEQSKMLHGIQAKSKKRKMAAGTDGEIFGAVPDAKARTFQQVSQISKA
ADQHEQPDRVTRVLSKIF*
Coding >OphauB2|2719
ATGGCACCTCAAATACGAAACAACTTTCTCGATGCATCGGAGAGTGACGATGATGCAAATGATGGCTATGAATCC
CCCGACGAGCTGGCAAAAGGTGGTGGCAGTGTCAAACGGCGGAAGCTTGATAGCGACGACAACAACGGGGACGAA
GATGGCGAGGATGAGTTCAACGATGTGGACTTGGCAGAGACGAACAACGCCATTGGAGATGCATCTGAAACAAGT
GAAGGTCAGATACCAAAGGCTATCAAGCCTAAGCACGAGCGCGAGGCCAAACTATCCTCAATTAGCAAGCCGCTG
TCCAAGAAGAACTTGGTCGATACAGAAAAAGCAATAAAGAAGTCTGGCGTCGTCTTCCTATCACGGGTTCCGCCA
TTTATGAGGCCCAATAAGCTGCGCTCTCTGCTGCAGCCCTACGGCGTGATTAATCGCATCTTCCTCGCTCCTGAA
GACCCGGCTCTCCACTCTCGCCGCGTCCGTGCAGGAGGAAACAAGAGGCGCTCTTTCACAGAAGGCTGGGTCGAG
TTTGTCAAGAAGAAGGAGGCCAAGGCTGCGTGCGAGCTGTTGAATGCACGCATCGTTGGTGGTAAGAAGAGCAGC
TATTATCACGACGATATCTGGAACCTGCTCTATTTAAAGGGGTTCAAGTGGCACCACCTCACCGAACAGATTACT
ACCGAGAATGCGGAGAGGACGAGCCGCATGAGAGCCGAGATATCTCGGGCCACAAAGGAGAATAAGGAGTTTGTG
AAAAATGTAGAGCAGTCCAAGATGCTCCATGGCATACAGGCAAAGTCGAAAAAGAGGAAAATGGCAGCCGGGACT
GACGGCGAGATTTTTGGCGCTGTTCCTGACGCGAAAGCTCGCACCTTTCAGCAGGTCTCGCAAATCAGCAAAGCC
GCTGACCAACATGAGCAGCCGGATAGGGTGACGAGGGTCTTGAGCAAGATATTTTAG
Transcript >OphauB2|2719
ATGGCACCTCAAATACGAAACAACTTTCTCGATGCATCGGAGAGTGACGATGATGCAAATGATGGCTATGAATCC
CCCGACGAGCTGGCAAAAGGTGGTGGCAGTGTCAAACGGCGGAAGCTTGATAGCGACGACAACAACGGGGACGAA
GATGGCGAGGATGAGTTCAACGATGTGGACTTGGCAGAGACGAACAACGCCATTGGAGATGCATCTGAAACAAGT
GAAGGTCAGATACCAAAGGCTATCAAGCCTAAGCACGAGCGCGAGGCCAAACTATCCTCAATTAGCAAGCCGCTG
TCCAAGAAGAACTTGGTCGATACAGAAAAAGCAATAAAGAAGTCTGGCGTCGTCTTCCTATCACGGGTTCCGCCA
TTTATGAGGCCCAATAAGCTGCGCTCTCTGCTGCAGCCCTACGGCGTGATTAATCGCATCTTCCTCGCTCCTGAA
GACCCGGCTCTCCACTCTCGCCGCGTCCGTGCAGGAGGAAACAAGAGGCGCTCTTTCACAGAAGGCTGGGTCGAG
TTTGTCAAGAAGAAGGAGGCCAAGGCTGCGTGCGAGCTGTTGAATGCACGCATCGTTGGTGGTAAGAAGAGCAGC
TATTATCACGACGATATCTGGAACCTGCTCTATTTAAAGGGGTTCAAGTGGCACCACCTCACCGAACAGATTACT
ACCGAGAATGCGGAGAGGACGAGCCGCATGAGAGCCGAGATATCTCGGGCCACAAAGGAGAATAAGGAGTTTGTG
AAAAATGTAGAGCAGTCCAAGATGCTCCATGGCATACAGGCAAAGTCGAAAAAGAGGAAAATGGCAGCCGGGACT
GACGGCGAGATTTTTGGCGCTGTTCCTGACGCGAAAGCTCGCACCTTTCAGCAGGTCTCGCAAATCAGCAAAGCC
GCTGACCAACATGAGCAGCCGGATAGGGTGACGAGGGTCTTGAGCAAGATATTTTAG
Gene >OphauB2|2719
ATGGCACCTCAAATACGAAACAACTTTCTCGATGCATCGGAGAGTGACGATGATGCAAATGATGGCTATGAATCC
CCCGACGAGCTGGCAAAAGGTGGTGGCAGTGTCAAACGGCGGAAGCTTGATAGCGACGACAACAACGGGGACGAA
GATGGCGAGGATGAGTTCAACGATGTGGACTTGGCAGAGACGAACAACGCCATTGGAGATGCATCTGAAACAAGT
GAAGGTCAGATACCAAAGGCTATCAAGCCTAAGCACGAGCGCGAGGCCAAACTATCCTCAATTAGCAAGCCGCTG
TCCAAGAAGAACTTGGTCGATACAGAAAAAGCAATAAAGAAGTCTGGCGTCGTCTTCCTATCACGGGTTCCGCCA
TTTATGAGGCCCAATAAGCTGCGCTCTCTGCTGCAGCCCTACGGCGTGATTAATCGCATCTTCCTCGCTCCTGAA
GACCCGGCTCTCCACTCTCGCCGCGTCCGTGCAGGAGGAAACAAGAGGCGCTCTTTCACAGAAGGCTGGGTCGAG
TTTGTCAAGAAGAAGGAGGCCAAGGCTGCGTGCGAGCTGTTGAATGCACGCATCGTTGGTGGTAAGAAGAGCAGC
TATTATCACGACGATATCTGGAACCTGCTCTATTTAAAGGGGTTCAAGTGGCACCACCTCACCGAACAGATTACT
ACCGAGAATGCGGAGAGGACGAGCCGCATGAGAGCCGAGATATCTCGGGCCACAAAGGAGAATAAGGAGTTTGTG
AAAAATGTAGAGCAGTCCAAGATGCTCCATGGCATACAGGCAAAGTCGAAAAAGAGGAAAATGGCAGCCGGGACT
GACGGCGAGATTTTTGGCGCTGTTCCTGACGCGAAAGCTCGCACCTTTCAGCAGGTCTCGCAAATCAGCAAAGCC
GCTGACCAACATGAGCAGCCGGATAGGGTGACGAGGGTCTTGAGCAAGATATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail