Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2715
Gene name
LocationContig_19:88633..89809
Strand+
Gene length (bp)1176
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10496 Syntaxin-18_N SNARE-complex protein Syntaxin-18 N-terminus 1.5E-09 13 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VDS8|STX18_MOUSE Syntaxin-18 OS=Mus musculus GN=Stx18 PE=1 SV=2 44 342 1.0E-16
sp|O94531|UFE1_SCHPO Syntaxin ufe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufe1 PE=1 SV=1 44 346 4.0E-16
sp|Q5REB4|STX18_PONAB Syntaxin-18 OS=Pongo abelii GN=STX18 PE=2 SV=1 44 342 6.0E-16
sp|Q9P2W9|STX18_HUMAN Syntaxin-18 OS=Homo sapiens GN=STX18 PE=1 SV=1 44 342 6.0E-16
sp|Q68FW4|STX18_RAT Syntaxin-18 OS=Rattus norvegicus GN=Stx18 PE=2 SV=1 44 342 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VDS8|STX18_MOUSE Syntaxin-18 OS=Mus musculus GN=Stx18 PE=1 SV=2 44 342 1.0E-16
sp|O94531|UFE1_SCHPO Syntaxin ufe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufe1 PE=1 SV=1 44 346 4.0E-16
sp|Q5REB4|STX18_PONAB Syntaxin-18 OS=Pongo abelii GN=STX18 PE=2 SV=1 44 342 6.0E-16
sp|Q9P2W9|STX18_HUMAN Syntaxin-18 OS=Homo sapiens GN=STX18 PE=1 SV=1 44 342 6.0E-16
sp|Q68FW4|STX18_RAT Syntaxin-18 OS=Rattus norvegicus GN=Stx18 PE=2 SV=1 44 342 3.0E-15
sp|Q4VBI7|STX18_DANRE Syntaxin-18 OS=Danio rerio GN=stx18 PE=2 SV=1 132 342 3.0E-13
sp|P41834|UFE1_YEAST Syntaxin UFE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFE1 PE=1 SV=2 42 345 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2715
MALTGAAMPPDADLTSHFNQLLSEQDASTATGRTHLNLHVVEGFLKEAYRINSHITSLHKELRDVRRAYLSTAQP
HRTMGSMTQDQPRALTDREREDIDANAKQMIRELNASIRAMDEAEKLRRETESTVVRKKYARGLSVLSSWASGGS
ASIKTAEHATAEAQAKQTEMHRDGVLWFLRQRLELCCRTQQDMMETRLRREMDKTRGLMVPAATLFTDFDPSSNP
APPNAMPDKTPQAHLTEEQIQMFEEDNQDMIKQYESSLDKVRTAEKSLVEISELQSLLVNNLATQSAHIEQLVED
SLSTTDNVGGGNKELKKATQRPSAARYTFFAASGLCAFLVVWDLII*
Coding >OphauB2|2715
ATGGCACTGACTGGCGCCGCGATGCCGCCGGATGCAGATCTCACGTCCCACTTCAACCAGCTTCTCAGCGAGCAG
GATGCTTCCACCGCAACAGGCAGAACCCATCTGAATCTGCACGTCGTTGAAGGGTTCCTCAAAGAGGCATATCGA
ATTAACTCGCACATTACCAGTCTTCACAAAGAATTGAGAGATGTCCGGCGAGCGTATCTTTCAACGGCGCAGCCG
CACAGAACTATGGGCAGCATGACGCAGGACCAGCCTCGGGCCTTGACAGACCGTGAACGAGAGGATATAGATGCC
AACGCAAAGCAGATGATTCGCGAACTCAATGCCAGCATACGTGCCATGGACGAGGCGGAGAAATTACGACGCGAG
ACAGAATCGACAGTCGTCAGGAAGAAATACGCAAGGGGTCTGAGCGTGCTAAGCTCTTGGGCGTCTGGTGGAAGC
GCTAGCATCAAGACGGCAGAACACGCTACGGCCGAGGCTCAGGCCAAGCAGACAGAAATGCATCGCGACGGCGTG
CTCTGGTTTCTTCGGCAGAGACTGGAGCTATGCTGTCGCACACAGCAGGACATGATGGAGACTCGACTCAGACGC
GAGATGGATAAGACTCGTGGCCTCATGGTGCCGGCAGCAACACTCTTCACTGATTTTGACCCCTCATCAAATCCG
GCACCGCCTAACGCAATGCCGGATAAGACACCCCAGGCGCACTTGACTGAGGAGCAGATACAAATGTTTGAGGAG
GACAACCAAGACATGATAAAACAATATGAAAGTTCCTTGGATAAGGTCCGGACAGCTGAAAAGTCACTTGTTGAG
ATCTCGGAATTGCAGTCTTTACTAGTTAACAACTTGGCGACACAGTCTGCACATATTGAACAGCTGGTAGAGGAT
TCTTTATCAACGACGGACAATGTTGGAGGCGGCAACAAGGAGCTGAAGAAGGCGACGCAGAGGCCGAGTGCGGCA
CGCTATACCTTTTTTGCGGCCAGCGGCCTCTGCGCCTTTTTGGTGGTTTGGGATCTCATCATATGA
Transcript >OphauB2|2715
ATGGCACTGACTGGCGCCGCGATGCCGCCGGATGCAGATCTCACGTCCCACTTCAACCAGCTTCTCAGCGAGCAG
GATGCTTCCACCGCAACAGGCAGAACCCATCTGAATCTGCACGTCGTTGAAGGGTTCCTCAAAGAGGCATATCGA
ATTAACTCGCACATTACCAGTCTTCACAAAGAATTGAGAGATGTCCGGCGAGCGTATCTTTCAACGGCGCAGCCG
CACAGAACTATGGGCAGCATGACGCAGGACCAGCCTCGGGCCTTGACAGACCGTGAACGAGAGGATATAGATGCC
AACGCAAAGCAGATGATTCGCGAACTCAATGCCAGCATACGTGCCATGGACGAGGCGGAGAAATTACGACGCGAG
ACAGAATCGACAGTCGTCAGGAAGAAATACGCAAGGGGTCTGAGCGTGCTAAGCTCTTGGGCGTCTGGTGGAAGC
GCTAGCATCAAGACGGCAGAACACGCTACGGCCGAGGCTCAGGCCAAGCAGACAGAAATGCATCGCGACGGCGTG
CTCTGGTTTCTTCGGCAGAGACTGGAGCTATGCTGTCGCACACAGCAGGACATGATGGAGACTCGACTCAGACGC
GAGATGGATAAGACTCGTGGCCTCATGGTGCCGGCAGCAACACTCTTCACTGATTTTGACCCCTCATCAAATCCG
GCACCGCCTAACGCAATGCCGGATAAGACACCCCAGGCGCACTTGACTGAGGAGCAGATACAAATGTTTGAGGAG
GACAACCAAGACATGATAAAACAATATGAAAGTTCCTTGGATAAGGTCCGGACAGCTGAAAAGTCACTTGTTGAG
ATCTCGGAATTGCAGTCTTTACTAGTTAACAACTTGGCGACACAGTCTGCACATATTGAACAGCTGGTAGAGGAT
TCTTTATCAACGACGGACAATGTTGGAGGCGGCAACAAGGAGCTGAAGAAGGCGACGCAGAGGCCGAGTGCGGCA
CGCTATACCTTTTTTGCGGCCAGCGGCCTCTGCGCCTTTTTGGTGGTTTGGGATCTCATCATATGA
Gene >OphauB2|2715
ATGGCACTGACTGGCGCCGCGATGCCGCCGGATGCAGATCTCACGTCCCACTTCAACCAGCTTCTCAGCGAGCAG
GATGCTTCCACCGCAACAGGCAGAACCCATCTGAATCTGCACGTCGTTGAAGGGTTCCTCAAAGAGGCATATCGA
ATTGTCAGTTTTTCCACAAGCAGGGCATACTTCAATTTTCACCTTTACTGACGTGATACGTCGTCCGTCGTTAAG
AACTCGCACATTACCAGTCTTCACAAAGAATTGAGAGATGTCCGGCGAGCGTATCTTTCAACGGCGCAGCCGCAC
AGAACTATGGGCAGCATGACGCAGGACCAGCCTCGGGCCTTGACAGACCGTGAACGAGAGGATATAGATGCCAAC
GCAAAGCAGATGATTCGCGAACTCAATGCCAGCATACGTGCCATGGACGAGGCGGAGAAATTACGACGCGAGACA
GAATCGACAGTCGTCAGGAAGAAATACGCAAGGGGTCTGAGCGTGCTAAGCTCTTGGGCGTCTGGTGGAAGCGCT
AGCATCAAGACGGCAGAACACGCTACGGCCGAGGCTCAGGCCAAGCAGACAGAAATGCATCGCGACGGCGTGCTC
TGGTTTCTTCGGCAGAGACTGGAGCTATGCTGTCGCACACAGCAGGACATGATGGAGACTCGACTCAGACGCGAG
ATGGATAAGACTCGTGGCCTCATGGTGCCGGCAGCAACACTCTTCACTGATTTTGACCCCTCATCAAATCCGGCA
CCGCCTAACGCAATGCCGGATAAGACACCCCAGGCGCACTTGACTGAGGAGCAGATACAAATGTTTGAGGAGGAC
AACCAAGACATGATAAAACAATATGAAAGTTCCTTGGATAAGGTCCGGTAGGTTTTGGGCAATTTGCTACGAGAC
ACAGAGTCGGATGCTGACATGGCATGGCATGACAGGACAGCTGAAAAGTCACTTGTTGAGATCTCGGAATTGCAG
TCTTTACTAGTTAACAACTTGGCGACACAGTCTGCACATATTGAACAGCTGGTAGAGGATTCTTTATCAACGACG
GACAATGTTGGAGGCGGCAACAAGGAGCTGAAGAAGGCGACGCAGAGGCCGAGTGCGGCACGCTATACCTTTTTT
GCGGCCAGCGGCCTCTGCGCCTTTTTGGTGGTTTGGGATCTCATCATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail