Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2709
Gene name
LocationContig_19:74459..75223
Strand-
Gene length (bp)764
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like 1.2E-11 136 208

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3912
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|556
Ophiocordyceps australis map64 (Brazil) OphauB2|2709 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04089
Ophiocordyceps camponoti-rufipedis Ophun1|4222
Ophiocordyceps kimflemingae Ophio5|3752
Ophiocordyceps subramaniannii Hirsu2|7790

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2709
MSGNDKVASAGEIRLEQPEDAVAMHKMAQPSGAPDHTPGSEPVSDTPRPSKGKERADSAPKPPSKEENEGHMAIG
SAQDDHYDTSSAAPDAGPVCNITLLLTSGNRHPYKIDAKYLARRNVTVPDETEHGLPDPFSISVYTLKELILREW
RHDWEAKPASPTSIRLIHFGKLLDDKEQLRKYQFSVDHPNVVHMSIRPSDLDDEEPKAGSKAMPAGGAEGQDSRS
RRGCCVVL*
Coding >OphauB2|2709
ATGAGCGGCAACGACAAGGTCGCGTCGGCTGGCGAGATTCGCTTAGAGCAGCCAGAAGATGCTGTTGCCATGCAT
AAGATGGCGCAACCATCGGGCGCCCCCGACCACACGCCTGGCTCCGAGCCCGTGTCTGATACCCCTAGGCCGTCC
AAGGGCAAGGAACGGGCAGACAGCGCGCCAAAGCCACCGTCAAAAGAGGAAAACGAGGGCCACATGGCCATTGGC
TCTGCCCAGGACGATCATTACGACACCTCCTCAGCCGCCCCCGATGCTGGACCTGTCTGCAATATCACGCTGTTG
CTGACATCTGGCAATCGACATCCATACAAAATTGACGCCAAGTACCTCGCCAGACGCAACGTCACTGTCCCAGAC
GAGACGGAACATGGCCTCCCAGACCCCTTCAGCATCAGCGTTTATACGTTGAAGGAACTCATTCTGCGCGAATGG
CGTCACGATTGGGAAGCCAAACCTGCCAGTCCGACCAGCATACGCCTCATTCACTTTGGAAAACTGCTCGACGAT
AAGGAACAGCTGCGAAAGTATCAATTCAGCGTCGACCATCCCAATGTTGTACACATGAGCATACGGCCATCTGAC
CTCGATGATGAAGAGCCCAAGGCCGGATCTAAGGCGATGCCAGCTGGTGGTGCTGAAGGACAAGACTCGAGATCG
CGTCGAGGCTGCTGCGTTGTGCTTTGA
Transcript >OphauB2|2709
ATGAGCGGCAACGACAAGGTCGCGTCGGCTGGCGAGATTCGCTTAGAGCAGCCAGAAGATGCTGTTGCCATGCAT
AAGATGGCGCAACCATCGGGCGCCCCCGACCACACGCCTGGCTCCGAGCCCGTGTCTGATACCCCTAGGCCGTCC
AAGGGCAAGGAACGGGCAGACAGCGCGCCAAAGCCACCGTCAAAAGAGGAAAACGAGGGCCACATGGCCATTGGC
TCTGCCCAGGACGATCATTACGACACCTCCTCAGCCGCCCCCGATGCTGGACCTGTCTGCAATATCACGCTGTTG
CTGACATCTGGCAATCGACATCCATACAAAATTGACGCCAAGTACCTCGCCAGACGCAACGTCACTGTCCCAGAC
GAGACGGAACATGGCCTCCCAGACCCCTTCAGCATCAGCGTTTATACGTTGAAGGAACTCATTCTGCGCGAATGG
CGTCACGATTGGGAAGCCAAACCTGCCAGTCCGACCAGCATACGCCTCATTCACTTTGGAAAACTGCTCGACGAT
AAGGAACAGCTGCGAAAGTATCAATTCAGCGTCGACCATCCCAATGTTGTACACATGAGCATACGGCCATCTGAC
CTCGATGATGAAGAGCCCAAGGCCGGATCTAAGGCGATGCCAGCTGGTGGTGCTGAAGGACAAGACTCGAGATCG
CGTCGAGGCTGCTGCGTTGTGCTTTGA
Gene >OphauB2|2709
ATGAGCGGCAACGACAAGGTCGCGTCGGCTGGCGAGATTCGCTTAGAGCAGCCAGAAGATGCTGTTGCCATGCAT
AAGATGGCGCAACCATCGGGCGCCCCCGACCACACGCCTGGCTCCGAGCCCGTGTCTGATACCCCTAGGCCGTCC
AAGGGCAAGGAACGGGCAGACAGCGCGCCAAAGCCACCGTCAAAAGAGGAAAACGAGGGCCACATGGCCATTGGC
TCTGCCCAGGACGATCATTACGACACCTCCTCAGCCGCCCCCGATGCTGGACCTGTCTGCAATATCACGCTGTTG
CTGACATCTGGCAATCGACATCCATACAAAATTGACGCCAAGTACCTCGCCAGACGCAACGTCACTGTCCCAGAC
GAGACGGAACATGGCCTCCCAGACCCCTTCAGCATCAGCGTTTATACGTTGAAGGAACTCATTCTGCGCGAATGG
CGTCACGATTGGGAAGCCAAACCTGCCAGTCCGACCAGCATACGCCTCATTCACTTTGGAAAACTGCTCGACGAT
AAGGAACAGCTGCGAAGTATGAAGATGCACCCTTGTGCGCAAAGTTGTCAGGCCCTTGCTGACTATGTTTGACTT
TAGAGTATCAATTCAGCGTCGACCATCCCAATGTTGTACACATGAGCATACGGCCATCTGACCTCGATGATGAAG
AGCCCAAGGCCGGATCTAAGGCGATGCCAGCTGGTGGTGCTGAAGGACAAGACTCGAGATCGCGTCGAGGCTGCT
GCGTTGTGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail