Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2700
Gene name
LocationContig_19:42508..43455
Strand-
Gene length (bp)947
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08784 RPA_C Replication protein A C terminal 1.9E-16 165 266
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 1.4E-08 75 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92373|RFA2_SCHPO Replication factor A protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb2 PE=1 SV=1 3 268 2.0E-42
sp|P26754|RFA2_YEAST Replication factor A protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA2 PE=1 SV=1 1 271 8.0E-29
sp|Q6IP18|RFA2A_XENLA Replication protein A 32 kDa subunit-A OS=Xenopus laevis GN=rpa2-a PE=1 SV=1 18 268 8.0E-28
sp|Q6DFS2|RFA2_XENTR Replication protein A 32 kDa subunit OS=Xenopus tropicalis GN=rpa2 PE=2 SV=1 18 268 1.0E-27
sp|Q62193|RFA2_MOUSE Replication protein A 32 kDa subunit OS=Mus musculus GN=Rpa2 PE=1 SV=1 2 266 8.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92373|RFA2_SCHPO Replication factor A protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssb2 PE=1 SV=1 3 268 2.0E-42
sp|P26754|RFA2_YEAST Replication factor A protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFA2 PE=1 SV=1 1 271 8.0E-29
sp|Q6IP18|RFA2A_XENLA Replication protein A 32 kDa subunit-A OS=Xenopus laevis GN=rpa2-a PE=1 SV=1 18 268 8.0E-28
sp|Q6DFS2|RFA2_XENTR Replication protein A 32 kDa subunit OS=Xenopus tropicalis GN=rpa2 PE=2 SV=1 18 268 1.0E-27
sp|Q62193|RFA2_MOUSE Replication protein A 32 kDa subunit OS=Mus musculus GN=Rpa2 PE=1 SV=1 2 266 8.0E-27
sp|Q8LFJ8|RFA2B_ARATH Replication protein A 32 kDa subunit B OS=Arabidopsis thaliana GN=RPA2B PE=2 SV=1 16 268 9.0E-27
sp|Q63528|RFA2_RAT Replication protein A 32 kDa subunit OS=Rattus norvegicus GN=Rpa2 PE=2 SV=2 12 266 5.0E-26
sp|P15927|RFA2_HUMAN Replication protein A 32 kDa subunit OS=Homo sapiens GN=RPA2 PE=1 SV=1 18 266 2.0E-25
sp|Q5RC43|RFA2_PONAB Replication protein A 32 kDa subunit OS=Pongo abelii GN=RPA2 PE=2 SV=1 18 266 2.0E-25
sp|A1L2H9|RFA2B_XENLA Replication protein A 32 kDa subunit-B OS=Xenopus laevis GN=rpa2-b PE=2 SV=1 18 268 3.0E-25
sp|Q9ZQ19|RFA2A_ARATH Replication protein A 32 kDa subunit A OS=Arabidopsis thaliana GN=RPA2A PE=1 SV=2 7 272 7.0E-24
sp|Q6K9U2|RFA2A_ORYSJ Replication protein A 32 kDa subunit A OS=Oryza sativa subsp. japonica GN=RPA2A PE=1 SV=1 32 268 1.0E-22
sp|Q6H7J5|RFA2B_ORYSJ Replication protein A 32 kDa subunit B OS=Oryza sativa subsp. japonica GN=RPA2B PE=1 SV=1 37 268 9.0E-22
sp|Q23697|RFA2_CRIFA Replication protein A 28 kDa subunit OS=Crithidia fasciculata GN=RPA2 PE=3 SV=1 44 180 5.0E-14
sp|Q5Z8L1|RFA2C_ORYSJ Replication protein A 32 kDa subunit C OS=Oryza sativa subsp. japonica GN=RPA2C PE=1 SV=2 64 166 3.0E-13
sp|Q13156|RFA4_HUMAN Replication protein A 30 kDa subunit OS=Homo sapiens GN=RPA4 PE=1 SV=2 2 268 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2700
MSAYGAYSKTSYGAQGGEDSGGFFAGGSQQGSQSGGKSYQDESLRPVTIKQILEAEEPYSGADFRIDGSVVTQIT
FVGQVRNVSPQPTNITFKIDDGTGQVEVKKWIDADKQDDADPGFELDSYVRVWGRLKSFSNKRHVGAHVIRPISD
FNEINYHLLEATYVHLFYTRSAPGDAAAGANSDSMFVDGNHGNMAATTSAGPSKLSACGPAARKMYTFMEKASGG
GNEGIHLNHICSSTGMSVRDVLTAAEDLLGNGLIFTTVDDETWALLEY*
Coding >OphauB2|2700
ATGTCAGCATACGGAGCGTATTCCAAGACGTCTTACGGCGCACAGGGCGGCGAAGACTCGGGCGGCTTCTTCGCC
GGCGGCTCCCAGCAGGGAAGCCAAAGCGGAGGCAAGTCCTACCAAGACGAGTCGCTGCGGCCCGTCACCATCAAA
CAGATTCTCGAAGCCGAAGAACCATACTCAGGCGCAGATTTCCGGATCGATGGCTCCGTTGTGACGCAAATCACC
TTTGTGGGCCAAGTCCGCAACGTTAGTCCGCAGCCCACAAACATCACCTTCAAAATCGACGATGGAACTGGCCAG
GTCGAGGTGAAGAAGTGGATAGATGCCGACAAGCAAGACGATGCCGACCCGGGATTCGAACTCGATTCATATGTC
CGCGTTTGGGGTCGCCTCAAGTCCTTCTCCAACAAGCGCCATGTTGGCGCTCACGTCATCCGCCCCATTTCCGAC
TTTAACGAGATCAACTACCACTTGCTTGAAGCCACCTACGTCCACCTTTTTTACACTCGCAGCGCTCCCGGCGAC
GCTGCGGCTGGCGCTAATTCGGACAGCATGTTTGTCGACGGCAACCACGGAAACATGGCTGCAACGACCAGCGCG
GGTCCAAGCAAGCTCTCGGCCTGTGGCCCCGCAGCGAGAAAAATGTACACCTTTATGGAAAAGGCGTCGGGTGGT
GGTAACGAGGGAATTCACCTGAACCACATCTGCAGCTCGACAGGCATGTCTGTGCGAGATGTTCTAACAGCTGCT
GAAGATTTGCTCGGCAACGGTCTCATTTTCACAACGGTTGACGATGAAACCTGGGCCCTTTTGGAGTACTAG
Transcript >OphauB2|2700
ATGTCAGCATACGGAGCGTATTCCAAGACGTCTTACGGCGCACAGGGCGGCGAAGACTCGGGCGGCTTCTTCGCC
GGCGGCTCCCAGCAGGGAAGCCAAAGCGGAGGCAAGTCCTACCAAGACGAGTCGCTGCGGCCCGTCACCATCAAA
CAGATTCTCGAAGCCGAAGAACCATACTCAGGCGCAGATTTCCGGATCGATGGCTCCGTTGTGACGCAAATCACC
TTTGTGGGCCAAGTCCGCAACGTTAGTCCGCAGCCCACAAACATCACCTTCAAAATCGACGATGGAACTGGCCAG
GTCGAGGTGAAGAAGTGGATAGATGCCGACAAGCAAGACGATGCCGACCCGGGATTCGAACTCGATTCATATGTC
CGCGTTTGGGGTCGCCTCAAGTCCTTCTCCAACAAGCGCCATGTTGGCGCTCACGTCATCCGCCCCATTTCCGAC
TTTAACGAGATCAACTACCACTTGCTTGAAGCCACCTACGTCCACCTTTTTTACACTCGCAGCGCTCCCGGCGAC
GCTGCGGCTGGCGCTAATTCGGACAGCATGTTTGTCGACGGCAACCACGGAAACATGGCTGCAACGACCAGCGCG
GGTCCAAGCAAGCTCTCGGCCTGTGGCCCCGCAGCGAGAAAAATGTACACCTTTATGGAAAAGGCGTCGGGTGGT
GGTAACGAGGGAATTCACCTGAACCACATCTGCAGCTCGACAGGCATGTCTGTGCGAGATGTTCTAACAGCTGCT
GAAGATTTGCTCGGCAACGGTCTCATTTTCACAACGGTTGACGATGAAACCTGGGCCCTTTTGGAGTACTAG
Gene >OphauB2|2700
ATGTGTAAGACAAGACGCTCTTTGCAGCAAACTAGGCACTGATTTGGTTTAATTGATATAGCAGCATACGGAGCG
TATTCCAAGACGTCTTACGGCGCACAGGGCGGCGAAGACTCGGGCGGCTTCTTCGCCGGCGGCTCCCAGCAGGGA
AGCCAAAGCGGAGGCAAGGTGTGATTCGGCGCCTCTTTTCCTCCAACCATCGGTTGACAAAGCTGACTGGCATGG
TGAACACGCAGTCCTACCAAGACGAGTCGCTGCGGCCCGTCACCATCAAACAGATTCTCGAAGCCGAAGAACCAT
ACTCAGGCGCAGATTTCCGGATCGATGGCTCCGTTGTGACGCAAATCACCTTTGTGGGCCAAGTCCGCAACGTTA
GTCCGCAGCCCACAAACATCACCTTCAAAATCGACGATGGAACTGGCCAGGTCGAGGTGAAGAAGTGGATAGATG
CCGACAAGCAAGACGATGCCGACCCGGGATTCGAACTCGATTCATATGTCCGCGTTTGGGGTCGCCTCAAGTCCT
TCTCCAACAAGCGCCATGTTGGCGCTCACGTCATCCGCCCCATTTCCGACTTTAACGAGATCAACTACCACTTGC
TTGAAGCCACCTACGTCCACCTTTTTTACACTCGCAGCGCTCCCGGCGACGCTGCGGCTGGCGCTAATTCGGACA
GCATGTTTGTCGACGGCAACCACGGAAACATGGCTGCAACGACCAGCGCGGGTCCAAGCAAGCTCTCGGCCTGTG
GCCCCGCAGCGAGAAAAATGTACACCTTTATGGAAAAGGCGTCGGGTGGTGGTAACGAGGGAATTCACCTGAACC
ACATCTGCAGCTCGACAGGCATGTCTGTGCGAGATGTTCTAACAGCTGCTGAAGATTTGCTCGGCAACGGTCTCA
TTTTCACAACGGTTGACGATGAAACCTGGGCCCTTTTGGAGTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail