Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2699
Gene name
LocationContig_19:40489..41414
Strand+
Gene length (bp)925
Transcript length (bp)801
Coding sequence length (bp)801
Protein length (aa) 267

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 3.3E-09 164 221
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 1.6E-08 163 222
PF13527 Acetyltransf_9 Acetyltransferase (GNAT) domain 1.5E-07 158 223

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59806|YJV8_SCHPO Uncharacterized N-acetyltransferase C550.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.08 PE=3 SV=1 39 246 2.0E-41
sp|P13249|PUAC_STRAD Puromycin N-acetyltransferase OS=Streptomyces alboniger GN=pac PE=3 SV=2 167 245 1.0E-07

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016407 acetyltransferase activity No
GO:0016746 acyltransferase activity No
GO:0003674 molecular_function No
GO:0016410 N-acyltransferase activity No
GO:0016740 transferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2699
MHLQQLPQAQSQASQDRAGATQSAQPQSLIPSAWHTTIRDVSIKERDAAGLALAYSFAADPLSVYLLSGDNLKPQ
QAWKLHVRIMTYTFAAYRLKGIVTALGPDYDAIAMWTPPGKFMDGCWTTLQSGTWRLAYQLPAEARRRFFDELVP
ALHNTRERVMGSRNHDCYYLGYIGTKPSARGKGYASKLIQSMTDKADAENRPMYLESSAQGNIGFYTKFGFRIKT
QIELKRAATPVLLYCMVREPQGGQLQASSTESSNDVDKPEV*
Coding >OphauB2|2699
ATGCATCTGCAACAGCTACCGCAGGCTCAGTCTCAAGCCTCTCAGGACCGCGCAGGGGCCACTCAGTCCGCTCAG
CCTCAGTCCCTGATCCCCTCGGCCTGGCACACGACGATACGCGACGTCAGCATCAAAGAGCGTGACGCTGCTGGT
CTCGCTCTGGCCTATTCATTTGCTGCTGATCCTCTGAGCGTCTATCTCCTATCTGGCGACAATCTGAAGCCCCAA
CAGGCATGGAAACTCCACGTGCGCATCATGACGTACACGTTTGCCGCCTACCGCCTCAAGGGCATTGTCACGGCA
CTGGGCCCTGATTATGATGCCATTGCCATGTGGACGCCTCCCGGCAAGTTCATGGATGGCTGCTGGACTACGCTA
CAAAGTGGTACTTGGCGCCTCGCCTACCAGCTCCCGGCCGAGGCTCGCCGTCGATTCTTTGACGAGCTCGTGCCA
GCCTTGCACAATACTCGTGAGCGCGTCATGGGCAGCCGTAATCATGATTGCTACTATCTTGGCTACATCGGCACC
AAGCCCAGCGCCAGAGGGAAGGGCTATGCCTCCAAGTTGATACAATCCATGACAGACAAGGCCGATGCCGAGAAT
CGCCCCATGTACCTCGAGTCTTCGGCGCAGGGCAACATTGGTTTCTACACCAAGTTTGGTTTTAGAATCAAGACG
CAAATTGAGCTCAAGCGCGCTGCCACCCCTGTCCTGCTCTACTGCATGGTGCGTGAGCCTCAGGGCGGACAGCTC
CAAGCCTCCTCTACCGAGTCATCCAATGATGTTGACAAGCCTGAGGTTTGA
Transcript >OphauB2|2699
ATGCATCTGCAACAGCTACCGCAGGCTCAGTCTCAAGCCTCTCAGGACCGCGCAGGGGCCACTCAGTCCGCTCAG
CCTCAGTCCCTGATCCCCTCGGCCTGGCACACGACGATACGCGACGTCAGCATCAAAGAGCGTGACGCTGCTGGT
CTCGCTCTGGCCTATTCATTTGCTGCTGATCCTCTGAGCGTCTATCTCCTATCTGGCGACAATCTGAAGCCCCAA
CAGGCATGGAAACTCCACGTGCGCATCATGACGTACACGTTTGCCGCCTACCGCCTCAAGGGCATTGTCACGGCA
CTGGGCCCTGATTATGATGCCATTGCCATGTGGACGCCTCCCGGCAAGTTCATGGATGGCTGCTGGACTACGCTA
CAAAGTGGTACTTGGCGCCTCGCCTACCAGCTCCCGGCCGAGGCTCGCCGTCGATTCTTTGACGAGCTCGTGCCA
GCCTTGCACAATACTCGTGAGCGCGTCATGGGCAGCCGTAATCATGATTGCTACTATCTTGGCTACATCGGCACC
AAGCCCAGCGCCAGAGGGAAGGGCTATGCCTCCAAGTTGATACAATCCATGACAGACAAGGCCGATGCCGAGAAT
CGCCCCATGTACCTCGAGTCTTCGGCGCAGGGCAACATTGGTTTCTACACCAAGTTTGGTTTTAGAATCAAGACG
CAAATTGAGCTCAAGCGCGCTGCCACCCCTGTCCTGCTCTACTGCATGGTGCGTGAGCCTCAGGGCGGACAGCTC
CAAGCCTCCTCTACCGAGTCATCCAATGATGTTGACAAGCCTGAGGTTTGA
Gene >OphauB2|2699
ATGCATCTGCAACAGCTACCGCAGGCTCAGTCTCAAGCCTCTCAGGACCGCGCAGGGGCCACTCAGTCCGCTCAG
CCTCAGTCCCTGATCCCCTCGGCCTGGCACACGACGATACGCGACGTCAGCATCAAAGAGCGTGACGCTGCTGGT
CTCGCTCTGGCCTATTCATTTGCTGCTGATCCTCTGAGCGTCTATCTCCTATCTGGCGACAATCTGAAGCCCCAA
CAGGCATGGAAACTCCACGTGCGCATCATGACGTACACGTTTGCCGCCTACCGCCTCAAGGGCATTGTCACGGCA
CTGGGCCCTGATTATGATGCCATTGCCATGTGGTAAGTGTTAGCCCAGTTTATCTCAGGCAGTATCACAAGAAAC
ATGTCCAGTCCTGACATGATTAGGACGCCTCCCGGCAAGTTCATGGATGGCTGCTGGACTACGCTACAAAGTGGT
ACTTGGCGCCTCGCCTACCAGCTCCCGGCCGAGGCTCGCCGTCGATTCTTTGACGAGCTCGTGCCAGCCTTGCAC
AATACTCGTGAGCGCGTCATGGGCAGCCGTAATCATGATTGCTACTATCTTGGCTACATCGGCACCAAGCCCAGC
GCCAGAGGGAAGGGCTATGCCTCCAAGTTGATACAATCCATGACAGACAAGGTCAGCCATTTAACCCTCTCTTCA
TCCAGCTGGAAATTGCTCACCAGTCATGAATCAGGCCGATGCCGAGAATCGCCCCATGTACCTCGAGTCTTCGGC
GCAGGGCAACATTGGTTTCTACACCAAGTTTGGTTTTAGAATCAAGACGCAAATTGAGCTCAAGCGCGCTGCCAC
CCCTGTCCTGCTCTACTGCATGGTGCGTGAGCCTCAGGGCGGACAGCTCCAAGCCTCCTCTACCGAGTCATCCAA
TGATGTTGACAAGCCTGAGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail