Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2697
Gene name
LocationContig_19:36246..37588
Strand-
Gene length (bp)1342
Transcript length (bp)1191
Coding sequence length (bp)1191
Protein length (aa) 397

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12761 End3 Actin cytoskeleton-regulatory complex protein END3 3.9E-77 191 388
PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand 9.1E-47 3 104
PF00036 EF-hand_1 EF hand 7.5E-07 46 71

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT09|END3_MAGO7 Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=END3 PE=3 SV=1 1 396 0.0E+00
sp|L7IIY8|END3_MAGOY Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain Y34) GN=END3 PE=2 SV=1 1 396 0.0E+00
sp|A7E7N7|END3_SCLS1 Actin cytoskeleton-regulatory complex protein end3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=end3 PE=3 SV=1 4 395 0.0E+00
sp|A6SIJ6|END3_BOTFB Actin cytoskeleton-regulatory complex protein end3 OS=Botryotinia fuckeliana (strain B05.10) GN=end3 PE=3 SV=1 4 396 0.0E+00
sp|Q2H2V8|END3_CHAGB Actin cytoskeleton-regulatory complex protein END3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=END3 PE=3 SV=1 1 396 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT09|END3_MAGO7 Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=END3 PE=3 SV=1 1 396 0.0E+00
sp|L7IIY8|END3_MAGOY Actin cytoskeleton-regulatory complex protein END3 OS=Magnaporthe oryzae (strain Y34) GN=END3 PE=2 SV=1 1 396 0.0E+00
sp|A7E7N7|END3_SCLS1 Actin cytoskeleton-regulatory complex protein end3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=end3 PE=3 SV=1 4 395 0.0E+00
sp|A6SIJ6|END3_BOTFB Actin cytoskeleton-regulatory complex protein end3 OS=Botryotinia fuckeliana (strain B05.10) GN=end3 PE=3 SV=1 4 396 0.0E+00
sp|Q2H2V8|END3_CHAGB Actin cytoskeleton-regulatory complex protein END3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=END3 PE=3 SV=1 1 396 0.0E+00
sp|Q7S9V9|END3_NEUCR Actin cytoskeleton-regulatory complex protein end-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=end-3 PE=3 SV=2 1 396 0.0E+00
sp|B2AS96|END3_PODAN Actin cytoskeleton-regulatory complex protein END3 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=END3 PE=3 SV=1 1 395 0.0E+00
sp|Q5BEK7|END3_EMENI Actin cytoskeleton-regulatory complex protein end3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=end3 PE=2 SV=3 4 396 6.0E-175
sp|Q1DUU2|END3_COCIM Actin cytoskeleton-regulatory complex protein END3 OS=Coccidioides immitis (strain RS) GN=END3 PE=3 SV=1 4 395 8.0E-174
sp|A6RFP4|END3_AJECN Actin cytoskeleton-regulatory complex protein END3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=END3 PE=3 SV=2 4 395 3.0E-173
sp|Q4WSE8|END3_ASPFU Actin cytoskeleton-regulatory complex protein end3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=end3 PE=3 SV=1 4 396 8.0E-170
sp|B0XR88|END3_ASPFC Actin cytoskeleton-regulatory complex protein end3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=end3 PE=3 SV=1 4 396 8.0E-170
sp|A1D2B8|END3_NEOFI Actin cytoskeleton-regulatory complex protein end3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=end3 PE=3 SV=1 4 396 7.0E-169
sp|Q0D0N9|END3_ASPTN Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=end3 PE=3 SV=1 4 395 5.0E-167
sp|A1CPG1|END3_ASPCL Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=end3 PE=3 SV=1 4 395 6.0E-167
sp|A2QRG2|END3_ASPNC Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=end3 PE=3 SV=1 4 395 2.0E-166
sp|Q2UCH0|END3_ASPOR Actin cytoskeleton-regulatory complex protein end3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=end3 PE=3 SV=1 4 396 1.0E-165
sp|Q6C370|END3_YARLI Actin cytoskeleton-regulatory complex protein END3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=END3 PE=3 SV=1 4 396 1.0E-111
sp|A3M008|END3_PICST Actin cytoskeleton-regulatory complex protein END3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=END3 PE=3 SV=2 3 396 2.0E-106
sp|A5DF78|END3_PICGU Actin cytoskeleton-regulatory complex protein END3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=END3 PE=3 SV=2 3 391 2.0E-106
sp|Q5AJ82|END3_CANAL Actin cytoskeleton-regulatory complex protein END3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=END3 PE=2 SV=1 3 395 4.0E-102
sp|Q6BY77|END3_DEBHA Actin cytoskeleton-regulatory complex protein END3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=END3 PE=3 SV=2 3 393 2.0E-100
sp|A5DXI9|END3_LODEL Actin cytoskeleton-regulatory complex protein END3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=END3 PE=3 SV=1 3 359 2.0E-92
sp|Q9USZ7|END3_SCHPO Actin cytoskeleton-regulatory complex protein end3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=end3 PE=3 SV=1 5 393 7.0E-78
sp|Q755V2|END3_ASHGO Actin cytoskeleton-regulatory complex protein END3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=END3 PE=3 SV=2 3 395 1.0E-56
sp|Q6CTM9|END3_KLULA Actin cytoskeleton-regulatory complex protein END3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=END3 PE=3 SV=1 3 393 3.0E-55
sp|A7TEE6|END3_VANPO Actin cytoskeleton-regulatory complex protein END3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=END3 PE=3 SV=1 3 393 1.0E-46
sp|P39013|END3_YEAST Actin cytoskeleton-regulatory complex protein END3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=END3 PE=1 SV=1 3 391 4.0E-44
sp|A6ZRZ6|END3_YEAS7 Actin cytoskeleton-regulatory complex protein END3 OS=Saccharomyces cerevisiae (strain YJM789) GN=END3 PE=3 SV=1 3 391 7.0E-44
sp|Q6FP98|END3_CANGA Actin cytoskeleton-regulatory complex protein END3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=END3 PE=3 SV=1 3 391 5.0E-37
sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2 1 228 6.0E-20
sp|P42567|EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus GN=Eps15 PE=1 SV=1 1 226 1.0E-19
sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens GN=EPS15L1 PE=1 SV=1 2 225 2.0E-13
sp|Q75AA0|PAN1_ASHGO Actin cytoskeleton-regulatory complex protein PAN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN1 PE=3 SV=2 4 96 4.0E-13
sp|B2AWS3|PAN1_PODAN Actin cytoskeleton-regulatory complex protein PAN1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAN1 PE=3 SV=1 26 103 2.0E-12
sp|A5DP36|PAN1_PICGU Actin cytoskeleton-regulatory complex protein PAN1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN1 PE=3 SV=2 5 100 1.0E-11
sp|A4R8N4|PAN1_MAGO7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN1 PE=3 SV=2 26 103 5.0E-11
sp|A2R180|PAN1_ASPNC Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan1 PE=3 SV=1 26 100 6.0E-11
sp|Q0CPW4|PAN1_ASPTN Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan1 PE=3 SV=2 26 100 6.0E-11
sp|Q7SAT8|PAN1_NEUCR Actin cytoskeleton-regulatory complex protein pan-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan-1 PE=3 SV=1 26 100 6.0E-11
sp|Q6BNL1|PAN1_DEBHA Actin cytoskeleton-regulatory complex protein PAN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN1 PE=3 SV=2 5 100 7.0E-11
sp|Q2H922|PAN1_CHAGB Actin cytoskeleton-regulatory complex protein PAN1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN1 PE=3 SV=1 26 96 1.0E-10
sp|Q2UDY8|PAN1_ASPOR Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|B0YC95|PAN1_ASPFC Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|Q6CQX9|PAN1_KLULA Actin cytoskeleton-regulatory complex protein PAN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN1 PE=3 SV=1 5 96 1.0E-10
sp|A1DC51|PAN1_NEOFI Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|Q54KI4|EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum GN=eps15 PE=1 SV=1 5 208 1.0E-10
sp|A1CD74|PAN1_ASPCL Actin cytoskeleton-regulatory complex protein pan1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan1 PE=3 SV=1 26 100 1.0E-10
sp|Q4WG58|PAN1_ASPFU Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan1 PE=3 SV=1 26 100 2.0E-10
sp|A6S9N4|PAN1_BOTFB Actin cytoskeleton-regulatory complex protein pan1 OS=Botryotinia fuckeliana (strain B05.10) GN=pan1 PE=3 SV=1 14 96 3.0E-10
sp|P32521|PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN1 PE=1 SV=2 4 118 4.0E-10
sp|P42566|EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens GN=EPS15 PE=1 SV=2 21 225 5.0E-10
sp|A7EKZ0|PAN1_SCLS1 Actin cytoskeleton-regulatory complex protein pan1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pan1 PE=3 SV=1 1 96 5.0E-10
sp|Q5B5B0|PAN1_EMENI Actin cytoskeleton-regulatory complex protein pan1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan1 PE=3 SV=1 26 100 5.0E-10
sp|A6R7X5|PAN1_AJECN Actin cytoskeleton-regulatory complex protein PAN1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=PAN1 PE=3 SV=1 26 96 7.0E-10
sp|Q1DQC1|PAN1_COCIM Actin cytoskeleton-regulatory complex protein PAN1 OS=Coccidioides immitis (strain RS) GN=PAN1 PE=3 SV=1 26 100 1.0E-09
sp|Q60902|EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus GN=Eps15l1 PE=1 SV=3 5 80 2.0E-09
sp|Q6FPQ7|PAN1_CANGA Actin cytoskeleton-regulatory complex protein PAN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN1 PE=3 SV=1 5 100 2.0E-09
sp|A3LN86|PAN1_PICST Actin cytoskeleton-regulatory complex protein PAN1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN1 PE=3 SV=2 26 100 2.0E-08
sp|A6ZVS5|PAN1_YEAS7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAN1 PE=3 SV=2 36 118 2.0E-08
sp|Q6C908|PAN1_YARLI Actin cytoskeleton-regulatory complex protein PAN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN1 PE=3 SV=1 5 100 3.0E-08
sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 24 96 3.0E-08
sp|A7TSV7|PAN1_VANPO Actin cytoskeleton-regulatory complex protein PAN1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PAN1 PE=3 SV=1 5 100 5.0E-08
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 24 96 6.0E-08
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 24 96 7.0E-08
sp|O42287|ITSN1_XENLA Intersectin-1 OS=Xenopus laevis GN=itsn1 PE=1 SV=1 27 96 8.0E-08
sp|Q6CQX9|PAN1_KLULA Actin cytoskeleton-regulatory complex protein PAN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN1 PE=3 SV=1 21 131 2.0E-07
sp|Q6FPQ7|PAN1_CANGA Actin cytoskeleton-regulatory complex protein PAN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN1 PE=3 SV=1 5 80 2.0E-07
sp|P42567|EPS15_MOUSE Epidermal growth factor receptor substrate 15 OS=Mus musculus GN=Eps15 PE=1 SV=1 32 219 3.0E-07
sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=3 SV=1 3 222 5.0E-07
sp|Q9UBC2|EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens GN=EPS15L1 PE=1 SV=1 11 230 5.0E-07
sp|A5DVD6|PAN1_LODEL Actin cytoskeleton-regulatory complex protein PAN1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN1 PE=3 SV=1 5 100 6.0E-07
sp|P32521|PAN1_YEAST Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN1 PE=1 SV=2 21 80 7.0E-07
sp|A6ZVS5|PAN1_YEAS7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAN1 PE=3 SV=2 21 80 8.0E-07
sp|Q5RBP4|EHD1_PONAB EH domain-containing protein 1 OS=Pongo abelii GN=EHD1 PE=2 SV=1 5 97 8.0E-07
sp|Q9H4M9|EHD1_HUMAN EH domain-containing protein 1 OS=Homo sapiens GN=EHD1 PE=1 SV=2 5 97 8.0E-07
sp|Q5E9R3|EHD1_BOVIN EH domain-containing protein 1 OS=Bos taurus GN=EHD1 PE=1 SV=1 5 97 9.0E-07
sp|A7TSV7|PAN1_VANPO Actin cytoskeleton-regulatory complex protein PAN1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PAN1 PE=3 SV=1 5 80 1.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 26 89 1.0E-06
sp|Q5B5B0|PAN1_EMENI Actin cytoskeleton-regulatory complex protein pan1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan1 PE=3 SV=1 5 92 1.0E-06
sp|Q641Z6|EHD1_RAT EH domain-containing protein 1 OS=Rattus norvegicus GN=Ehd1 PE=1 SV=1 5 97 1.0E-06
sp|Q9WVK4|EHD1_MOUSE EH domain-containing protein 1 OS=Mus musculus GN=Ehd1 PE=1 SV=1 5 97 1.0E-06
sp|B0YC95|PAN1_ASPFC Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pan1 PE=3 SV=1 5 113 4.0E-06
sp|Q4WG58|PAN1_ASPFU Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan1 PE=3 SV=1 5 92 4.0E-06
sp|Q9NZN4|EHD2_HUMAN EH domain-containing protein 2 OS=Homo sapiens GN=EHD2 PE=1 SV=2 5 97 4.0E-06
sp|Q4V8H8|EHD2_RAT EH domain-containing protein 2 OS=Rattus norvegicus GN=Ehd2 PE=1 SV=1 5 97 4.0E-06
sp|Q8BH64|EHD2_MOUSE EH domain-containing protein 2 OS=Mus musculus GN=Ehd2 PE=1 SV=1 5 97 4.0E-06
sp|A1DC51|PAN1_NEOFI Actin cytoskeleton-regulatory complex protein pan1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan1 PE=3 SV=1 5 113 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006897 endocytosis Yes
GO:0005515 protein binding Yes
GO:0005509 calcium ion binding Yes
GO:0007015 actin filament organization Yes
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0016043 cellular component organization No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0097435 supramolecular fiber organization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0016192 vesicle-mediated transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2697
MPPKIEAKEVETYWNIFADRTGGSQFLTGEQAAPVLKNSGLRDDQLERVWDLADVDNDGNLDFEEFCVAMRVIFD
ILNGEYTDVPKTLPDWLVPESKAHLVQASRAITGKQPQFEHVDDDSDEQGLKDGFDWYMSPQDKSKYESIYQENR
DMRGEISFNSLEDLYASLDVPDTDVRSAWNLVNPSARQTINKDASLAFLHILNNRHEGFRIPRTVPASLRSSFER
NQIDYQLGSQRTGAASRWAAKADDSTSTGRKAKFGDQYLTRLGRSGFKASGTDFSTEKTEDWEEVRLKRQLQDLE
AKMQKVEEIAARRQGGKRESKPALVKRELDQLLDYKRRQLRELEEGTGKAAVGGSLKSVSEDLQTIREQVEGLES
HLRSRQQVLDDLRQQIEAEKA*
Coding >OphauB2|2697
ATGCCCCCAAAGATCGAGGCCAAAGAGGTTGAAACATATTGGAACATATTTGCCGACCGCACTGGCGGTTCTCAA
TTCCTCACGGGCGAGCAGGCTGCTCCTGTGCTCAAGAATAGCGGCTTGCGGGACGACCAACTGGAACGAGTATGG
GACTTGGCCGATGTTGACAACGATGGAAACCTCGATTTCGAAGAGTTTTGCGTCGCCATGCGAGTCATCTTTGAT
ATACTCAACGGCGAATATACCGATGTTCCCAAGACACTCCCAGACTGGCTGGTCCCCGAATCCAAAGCCCATCTA
GTGCAGGCCAGTCGCGCGATTACGGGCAAGCAGCCACAGTTTGAGCACGTCGACGATGATTCAGATGAGCAAGGG
CTCAAGGATGGTTTTGATTGGTATATGAGCCCGCAAGACAAGTCCAAGTACGAGTCGATCTATCAGGAGAACCGA
GATATGCGGGGCGAAATATCATTTAATTCCCTCGAGGATTTATACGCGTCGCTCGACGTCCCCGACACCGACGTT
CGCTCAGCCTGGAACTTAGTCAACCCTTCGGCACGACAAACCATTAACAAGGATGCTAGTCTTGCCTTTTTACAC
ATCTTGAATAACCGCCATGAGGGCTTCCGCATCCCGCGTACCGTACCTGCTTCTCTACGATCGAGCTTTGAAAGA
AACCAAATAGATTACCAGCTCGGTTCTCAGCGCACAGGTGCTGCTTCGCGGTGGGCAGCAAAAGCCGACGACTCG
ACATCAACAGGGCGGAAAGCAAAGTTTGGCGACCAGTATCTCACCCGCCTCGGCCGCAGCGGCTTCAAGGCCTCA
GGTACCGACTTTTCGACAGAAAAGACGGAAGACTGGGAGGAGGTACGCCTGAAGCGCCAGCTACAAGATCTAGAG
GCCAAGATGCAAAAAGTTGAGGAGATTGCTGCGCGTCGTCAGGGAGGCAAGCGAGAATCGAAGCCTGCGCTGGTC
AAAAGGGAGCTCGACCAATTGCTCGACTATAAACGTCGGCAGCTGCGGGAGCTGGAAGAGGGCACCGGCAAAGCA
GCTGTAGGTGGGAGTCTAAAGAGTGTGTCTGAAGACTTGCAAACTATCCGCGAGCAAGTTGAGGGCCTAGAGTCT
CATTTGCGATCAAGACAGCAAGTGCTTGATGACCTGCGACAGCAAATCGAGGCCGAGAAGGCGTAA
Transcript >OphauB2|2697
ATGCCCCCAAAGATCGAGGCCAAAGAGGTTGAAACATATTGGAACATATTTGCCGACCGCACTGGCGGTTCTCAA
TTCCTCACGGGCGAGCAGGCTGCTCCTGTGCTCAAGAATAGCGGCTTGCGGGACGACCAACTGGAACGAGTATGG
GACTTGGCCGATGTTGACAACGATGGAAACCTCGATTTCGAAGAGTTTTGCGTCGCCATGCGAGTCATCTTTGAT
ATACTCAACGGCGAATATACCGATGTTCCCAAGACACTCCCAGACTGGCTGGTCCCCGAATCCAAAGCCCATCTA
GTGCAGGCCAGTCGCGCGATTACGGGCAAGCAGCCACAGTTTGAGCACGTCGACGATGATTCAGATGAGCAAGGG
CTCAAGGATGGTTTTGATTGGTATATGAGCCCGCAAGACAAGTCCAAGTACGAGTCGATCTATCAGGAGAACCGA
GATATGCGGGGCGAAATATCATTTAATTCCCTCGAGGATTTATACGCGTCGCTCGACGTCCCCGACACCGACGTT
CGCTCAGCCTGGAACTTAGTCAACCCTTCGGCACGACAAACCATTAACAAGGATGCTAGTCTTGCCTTTTTACAC
ATCTTGAATAACCGCCATGAGGGCTTCCGCATCCCGCGTACCGTACCTGCTTCTCTACGATCGAGCTTTGAAAGA
AACCAAATAGATTACCAGCTCGGTTCTCAGCGCACAGGTGCTGCTTCGCGGTGGGCAGCAAAAGCCGACGACTCG
ACATCAACAGGGCGGAAAGCAAAGTTTGGCGACCAGTATCTCACCCGCCTCGGCCGCAGCGGCTTCAAGGCCTCA
GGTACCGACTTTTCGACAGAAAAGACGGAAGACTGGGAGGAGGTACGCCTGAAGCGCCAGCTACAAGATCTAGAG
GCCAAGATGCAAAAAGTTGAGGAGATTGCTGCGCGTCGTCAGGGAGGCAAGCGAGAATCGAAGCCTGCGCTGGTC
AAAAGGGAGCTCGACCAATTGCTCGACTATAAACGTCGGCAGCTGCGGGAGCTGGAAGAGGGCACCGGCAAAGCA
GCTGTAGGTGGGAGTCTAAAGAGTGTGTCTGAAGACTTGCAAACTATCCGCGAGCAAGTTGAGGGCCTAGAGTCT
CATTTGCGATCAAGACAGCAAGTGCTTGATGACCTGCGACAGCAAATCGAGGCCGAGAAGGCGTAA
Gene >OphauB2|2697
ATGCCCCCAAAGATCGAGGCCAAAGAGGTTGAAACATATTGGAACATATTTGCCGACCGCACTGGCGGTTCTCAA
TTCCTCACGGGCGAGCAGGCTGCTCCTGTGCTCAAGAATAGCGGCTTGCGGGACGACCAACTGGAACGAGTATGG
GACTTGGCCGATGTTGACAACGATGGAAACCTCGATTTCGAAGAGTTTTGCGTCGCCATGCGAGTCATCTTTGAT
ATACTCAACGGCGTAAGAGCGCCTTCTAAGCCGCAATGGACTGGCCAGCTCACTGTCCACCCGCGTAGGAATATA
CCGATGTTCCCAAGACACTCCCAGACTGGCTGGTCCCCGAATCCAAAGCCCATCTAGTGCAGGCCAGTCGCGCGA
TTACGGGCAAGCAGCCACAGTTTGAGCACGTCGACGATGATTCAGATGAGCAAGGGCTCAAGGATGGTTTTGATT
GGTATATGAGCCCGCAAGACAAGTCCAAGTACGAGTCGATCTATCAGGAGAACCGAGATATGCGGGGCGAAATAT
CATGCAAGTTACTGTTCTTCCTTCCTAGTGGTGGCTCAGGCACATTTCTTTCTTGCTTGCCCCTATGTGTATGCT
GACGTCACGCTTGATACTACTAGTTAATTCCCTCGAGGATTTATACGCGTCGCTCGACGTCCCCGACACCGACGT
TCGCTCAGCCTGGAACTTAGTCAACCCTTCGGCACGACAAACCATTAACAAGGATGCTAGTCTTGCCTTTTTACA
CATCTTGAATAACCGCCATGAGGGCTTCCGCATCCCGCGTACCGTACCTGCTTCTCTACGATCGAGCTTTGAAAG
AAACCAAATAGATTACCAGCTCGGTTCTCAGCGCACAGGTGCTGCTTCGCGGTGGGCAGCAAAAGCCGACGACTC
GACATCAACAGGGCGGAAAGCAAAGTTTGGCGACCAGTATCTCACCCGCCTCGGCCGCAGCGGCTTCAAGGCCTC
AGGTACCGACTTTTCGACAGAAAAGACGGAAGACTGGGAGGAGGTACGCCTGAAGCGCCAGCTACAAGATCTAGA
GGCCAAGATGCAAAAAGTTGAGGAGATTGCTGCGCGTCGTCAGGGAGGCAAGCGAGAATCGAAGCCTGCGCTGGT
CAAAAGGGAGCTCGACCAATTGCTCGACTATAAACGTCGGCAGCTGCGGGAGCTGGAAGAGGGCACCGGCAAAGC
AGCTGTAGGTGGGAGTCTAAAGAGTGTGTCTGAAGACTTGCAAACTATCCGCGAGCAAGTTGAGGGCCTAGAGTC
TCATTTGCGATCAAGACAGCAAGTGCTTGATGACCTGCGACAGCAAATCGAGGCCGAGAAGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail