Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2678
Gene name
LocationContig_189:17126..18528
Strand-
Gene length (bp)1402
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00266 Aminotran_5 Aminotransferase class-V 5.1E-19 35 346

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43567|AGX1_YEAST Alanine--glyoxylate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGX1 PE=1 SV=1 14 382 2.0E-103
sp|Q58369|Y959_METJA Uncharacterized aminotransferase MJ0959 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0959 PE=3 SV=1 15 388 1.0E-39
sp|Q9X1C0|SAT_THEMA Serine-pyruvate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1400 PE=1 SV=1 15 388 2.0E-39
sp|O08374|SGAA_HYPME Serine--glyoxylate aminotransferase OS=Hyphomicrobium methylovorum GN=sgaA PE=3 SV=2 13 361 1.0E-35
sp|P31030|SPYA_RABIT Serine--pyruvate aminotransferase OS=Oryctolagus cuniculus GN=AGXT PE=2 SV=1 12 385 6.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43567|AGX1_YEAST Alanine--glyoxylate aminotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGX1 PE=1 SV=1 14 382 2.0E-103
sp|Q58369|Y959_METJA Uncharacterized aminotransferase MJ0959 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0959 PE=3 SV=1 15 388 1.0E-39
sp|Q9X1C0|SAT_THEMA Serine-pyruvate aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1400 PE=1 SV=1 15 388 2.0E-39
sp|O08374|SGAA_HYPME Serine--glyoxylate aminotransferase OS=Hyphomicrobium methylovorum GN=sgaA PE=3 SV=2 13 361 1.0E-35
sp|P31030|SPYA_RABIT Serine--pyruvate aminotransferase OS=Oryctolagus cuniculus GN=AGXT PE=2 SV=1 12 385 6.0E-35
sp|P09139|SPYA_RAT Serine--pyruvate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Agxt PE=1 SV=1 15 385 7.0E-35
sp|P21549|SPYA_HUMAN Serine--pyruvate aminotransferase OS=Homo sapiens GN=AGXT PE=1 SV=1 15 388 1.0E-34
sp|Q5RDP0|SPYA_PONAB Serine--pyruvate aminotransferase OS=Pongo abelii GN=AGXT PE=2 SV=1 54 388 2.0E-34
sp|P31029|SPYA_CALJA Serine--pyruvate aminotransferase, mitochondrial OS=Callithrix jacchus GN=AGXT PE=2 SV=1 15 385 2.0E-34
sp|P14776|DHSS_SYNP1 Soluble hydrogenase, small subunit OS=Synechococcus sp. (strain PCC 6716) PE=3 SV=1 10 387 3.0E-34
sp|P55819|SGAA_METEA Serine--glyoxylate aminotransferase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=sgaA PE=3 SV=2 3 360 7.0E-34
sp|P41689|SPYA_FELCA Serine--pyruvate aminotransferase, mitochondrial OS=Felis catus GN=AGXT PE=2 SV=1 15 385 4.0E-33
sp|O35423|SPYA_MOUSE Serine--pyruvate aminotransferase, mitochondrial OS=Mus musculus GN=Agxt PE=1 SV=3 15 385 8.0E-33
sp|Q56YA5|SGAT_ARATH Serine--glyoxylate aminotransferase OS=Arabidopsis thaliana GN=AGT1 PE=1 SV=2 15 360 2.0E-32
sp|O32148|PUCG_BACSU Purine catabolism protein PucG OS=Bacillus subtilis (strain 168) GN=pucG PE=1 SV=1 14 382 3.0E-32
sp|P16421|DHSS_ANACY Soluble hydrogenase 42 kDa subunit OS=Anabaena cylindrica PE=1 SV=1 15 388 9.0E-32
sp|Q54GT6|SPYA_DICDI Serine--pyruvate aminotransferase OS=Dictyostelium discoideum GN=agxt PE=3 SV=1 15 388 1.0E-29
sp|Q988B8|PPAT_RHILO Pyridoxamine--pyruvate transaminase OS=Rhizobium loti (strain MAFF303099) GN=ppaT PE=1 SV=1 16 362 3.0E-20
sp|Q9ZLA7|Y736_HELPJ Uncharacterized aminotransferase jhp_0673 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0673 PE=3 SV=1 15 364 3.0E-14
sp|A6L4N0|PHNW_BACV8 2-aminoethylphosphonate--pyruvate transaminase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=phnW PE=3 SV=1 15 379 6.0E-10
sp|A5W695|PHNW_PSEP1 2-aminoethylphosphonate--pyruvate transaminase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=phnW PE=3 SV=1 13 379 1.0E-09
sp|Q88KT0|PHNW_PSEPK 2-aminoethylphosphonate--pyruvate transaminase OS=Pseudomonas putida (strain KT2440) GN=phnW PE=3 SV=1 13 379 1.0E-09
sp|B0KIG1|PHNW_PSEPG 2-aminoethylphosphonate--pyruvate transaminase OS=Pseudomonas putida (strain GB-1) GN=phnW PE=3 SV=1 13 379 2.0E-09
sp|B1JBM5|PHNW_PSEPW 2-aminoethylphosphonate--pyruvate transaminase OS=Pseudomonas putida (strain W619) GN=phnW PE=3 SV=1 50 379 3.0E-09
sp|Q4K9L8|PHNW_PSEF5 2-aminoethylphosphonate--pyruvate transaminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=phnW PE=3 SV=1 11 384 4.0E-09
sp|B1Z0T3|PHNW_BURA4 2-aminoethylphosphonate--pyruvate transaminase OS=Burkholderia ambifaria (strain MC40-6) GN=phnW PE=3 SV=1 13 277 4.0E-09
sp|Q8RSQ4|PHNW_PSEPU 2-aminoethylphosphonate--pyruvate transaminase OS=Pseudomonas putida GN=phnW PE=3 SV=1 13 379 2.0E-08
sp|Q1BQZ3|PHNW_BURCA 2-aminoethylphosphonate--pyruvate transaminase OS=Burkholderia cenocepacia (strain AU 1054) GN=phnW PE=3 SV=1 13 277 2.0E-08
sp|Q39AP8|PHNW1_BURL3 2-aminoethylphosphonate--pyruvate transaminase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=phnW1 PE=3 SV=1 13 277 9.0E-08
sp|B2JLS3|PHNW_BURP8 2-aminoethylphosphonate--pyruvate transaminase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=phnW PE=3 SV=1 13 277 2.0E-07
sp|A9VKQ3|PHNW_BACWK 2-aminoethylphosphonate--pyruvate transaminase OS=Bacillus weihenstephanensis (strain KBAB4) GN=phnW PE=3 SV=1 10 378 3.0E-07
sp|B1HPR6|PHNW_LYSSC 2-aminoethylphosphonate--pyruvate transaminase OS=Lysinibacillus sphaericus (strain C3-41) GN=phnW PE=3 SV=1 54 379 4.0E-07
sp|C3LVL9|PHNW_VIBCM 2-aminoethylphosphonate--pyruvate transaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=phnW PE=3 SV=1 15 382 4.0E-07
sp|Q9KLY7|PHNW_VIBCH 2-aminoethylphosphonate--pyruvate transaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=phnW PE=3 SV=1 15 382 4.0E-07
sp|A5F049|PHNW_VIBC3 2-aminoethylphosphonate--pyruvate transaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=phnW PE=3 SV=1 15 382 4.0E-07
sp|Q92UV9|PHNW_RHIME 2-aminoethylphosphonate--pyruvate transaminase OS=Rhizobium meliloti (strain 1021) GN=phnW PE=3 SV=1 12 209 3.0E-06
sp|Q63E45|PHNW_BACCZ 2-aminoethylphosphonate--pyruvate transaminase OS=Bacillus cereus (strain ZK / E33L) GN=phnW PE=3 SV=1 10 378 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2678
MAANTSATAQSHPTLLIPGPIEFDDAVLHSMSHYSESHVGPGFVATFGETLSMLRQLFQTTDPASQPFVISGSGT
LGWDLVAANFLERGDKALVLSTGYFGDSFADCLKTYGADVTRLTAPVGGRPQLAEIEHALSATRYKMLTVTHVDT
STGVLSELKPLMAVVNKVSPDTLVIVDGVCSVGCEEIAFDDWGIDGVITASQKAIGCPAGLSISMFSGRAIDLVK
NKKTEPMTYYASIKKWLPIMQNYEAKKPSYFATPSSQLIRALHTSLKQILAQPLSDRFQKHIVVSDKVKKAVTDL
GLRIVAAKPEDQSHAMTAIYLPDKVTIPDLLPKLLSKGIIFAGGIHKDIATKYIRFGHMGVTVVDTKRDDVDRAI
EALKAALAECGYKGA*
Coding >OphauB2|2678
ATGGCTGCCAACACTTCAGCCACGGCGCAGTCGCATCCGACGCTGCTCATTCCAGGACCCATTGAGTTTGATGAT
GCCGTCCTCCACTCCATGAGCCACTACAGCGAGAGCCACGTGGGCCCCGGCTTCGTTGCCACGTTTGGCGAGACG
CTGTCAATGCTGCGCCAGCTCTTTCAGACAACGGACCCGGCCTCACAGCCGTTTGTCATAAGTGGCTCTGGCACC
CTTGGCTGGGATCTTGTGGCAGCAAACTTTCTCGAGCGCGGCGACAAGGCTCTCGTCCTTAGCACGGGCTACTTT
GGAGATTCTTTCGCCGATTGTCTCAAGACGTATGGCGCCGACGTGACGAGACTCACGGCTCCAGTTGGTGGTCGG
CCGCAGCTTGCAGAGATTGAACATGCTCTTTCAGCCACCAGGTACAAGATGCTCACCGTCACGCACGTTGACACT
TCGACGGGCGTTCTAAGCGAGCTCAAACCCCTCATGGCTGTCGTCAACAAGGTTTCCCCAGACACACTTGTCATA
GTAGACGGTGTCTGCAGCGTGGGCTGCGAAGAGATTGCATTTGATGACTGGGGAATTGATGGCGTCATTACAGCC
AGCCAAAAAGCGATTGGCTGTCCTGCCGGGCTTTCCATCTCCATGTTTAGCGGACGAGCCATTGACTTGGTCAAA
AATAAAAAGACGGAGCCCATGACATACTACGCCTCAATAAAGAAGTGGCTGCCTATCATGCAGAACTATGAGGCA
AAGAAGCCGTCATATTTCGCAACGCCTTCGTCTCAGCTGATTCGTGCCCTCCACACGTCTCTCAAACAAATTCTT
GCCCAACCACTGTCTGACCGTTTTCAAAAACACATTGTGGTCTCTGACAAGGTCAAAAAGGCAGTGACGGACTTG
GGCCTGAGAATAGTCGCCGCCAAACCTGAGGACCAGTCTCATGCCATGACAGCCATCTACCTGCCCGACAAGGTT
ACGATTCCAGACTTGCTGCCAAAGCTGCTGAGCAAGGGCATCATCTTCGCTGGCGGTATACATAAGGATATCGCC
ACCAAGTATATCCGATTTGGCCATATGGGCGTCACAGTGGTCGATACCAAGCGAGACGATGTCGACAGGGCAATT
GAAGCTCTGAAGGCGGCGTTGGCTGAGTGCGGTTACAAGGGCGCGTAG
Transcript >OphauB2|2678
ATGGCTGCCAACACTTCAGCCACGGCGCAGTCGCATCCGACGCTGCTCATTCCAGGACCCATTGAGTTTGATGAT
GCCGTCCTCCACTCCATGAGCCACTACAGCGAGAGCCACGTGGGCCCCGGCTTCGTTGCCACGTTTGGCGAGACG
CTGTCAATGCTGCGCCAGCTCTTTCAGACAACGGACCCGGCCTCACAGCCGTTTGTCATAAGTGGCTCTGGCACC
CTTGGCTGGGATCTTGTGGCAGCAAACTTTCTCGAGCGCGGCGACAAGGCTCTCGTCCTTAGCACGGGCTACTTT
GGAGATTCTTTCGCCGATTGTCTCAAGACGTATGGCGCCGACGTGACGAGACTCACGGCTCCAGTTGGTGGTCGG
CCGCAGCTTGCAGAGATTGAACATGCTCTTTCAGCCACCAGGTACAAGATGCTCACCGTCACGCACGTTGACACT
TCGACGGGCGTTCTAAGCGAGCTCAAACCCCTCATGGCTGTCGTCAACAAGGTTTCCCCAGACACACTTGTCATA
GTAGACGGTGTCTGCAGCGTGGGCTGCGAAGAGATTGCATTTGATGACTGGGGAATTGATGGCGTCATTACAGCC
AGCCAAAAAGCGATTGGCTGTCCTGCCGGGCTTTCCATCTCCATGTTTAGCGGACGAGCCATTGACTTGGTCAAA
AATAAAAAGACGGAGCCCATGACATACTACGCCTCAATAAAGAAGTGGCTGCCTATCATGCAGAACTATGAGGCA
AAGAAGCCGTCATATTTCGCAACGCCTTCGTCTCAGCTGATTCGTGCCCTCCACACGTCTCTCAAACAAATTCTT
GCCCAACCACTGTCTGACCGTTTTCAAAAACACATTGTGGTCTCTGACAAGGTCAAAAAGGCAGTGACGGACTTG
GGCCTGAGAATAGTCGCCGCCAAACCTGAGGACCAGTCTCATGCCATGACAGCCATCTACCTGCCCGACAAGGTT
ACGATTCCAGACTTGCTGCCAAAGCTGCTGAGCAAGGGCATCATCTTCGCTGGCGGTATACATAAGGATATCGCC
ACCAAGTATATCCGATTTGGCCATATGGGCGTCACAGTGGTCGATACCAAGCGAGACGATGTCGACAGGGCAATT
GAAGCTCTGAAGGCGGCGTTGGCTGAGTGCGGTTACAAGGGCGCGTAG
Gene >OphauB2|2678
ATGGCTGCCAACACTTCAGCCACGGCGCAGTCGCATCCGACGCTGCTCATTCCAGGACCCATTGAGTTTGATGAT
GCCGTCCTCCACTCCATGAGCCACTACAGGTGCGTTTGGTGTAGTTTCGCACCACAACAGCCCCCCCTCCCCTTC
CACCCCCTCTTTGGCTCTCCATGGCAATGCTAAATTGAGTAATGCTTGCCCAGCGAGAGCCACGTGGGCCCCGGC
TTCGTTGCCACGTTTGGCGAGACGCTGTCAATGCTGCGCCAGCTCTTTCAGACAACGGACCCGGCCTCACAGCCG
TTTGTCATAAGTGGCTCTGGCACCCTTGGCTGGGATCTTGTGGCAGCAAACTTTCTCGAGCGCGGCGACAAGGCT
CTCGTCCTTAGCACGGGCTACTTTGGAGATTCTTTCGCCGATTGTCTCAAGACGTATGGCGCCGACGTGACGAGA
CTCACGGCTCCAGTTGGTGGTCGGCCGCAGCTTGCAGAGATTGAACATGCTCTTTCAGCCACCAGGTACAAGATG
CTCACCGTCACGCACGTTGACACTTCGACGGGCGTTCTAAGCGAGCTCAAACCCCTCATGGCTGTCGTCAACAAG
GTTTCCCCAGACACACTTGTCATAGTAGACGGTGTCTGCAGCGTGGGCTGCGAAGAGATTGCATTTGATGACTGG
GGAATTGATGGCGTCATTACAGCCAGCCAAAAAGCGATTGGCTGTCCTGCCGGGCTTTCCATCTCCATGTTTAGC
GGACGAGCCATTGACTTGGTCAAAAATAAAAAGACGGAGCCCATGACATACTACGCCTCAATAAAGAAGTGGCTG
CCTAGTGAGCTGAACATCCATGGTCTCCACGTTGCATCTTGCCTCGTACTGACCATTGATGGCTCTAGTCATGCA
GAACTATGAGGCAAAGAAGCCGTCATATTTCGCAACGCCTTCGTCTCAGCTGATTCGTGCCCTCCACACGTCTCT
CAAACAAATTCTTGCCCAACCACTGTCTGACCGTTTTCAAAAACACATTGTGGTCTCTGACAAGGTCAAAAAGGC
AGTGACGGACTTGGGCCTGAGAATAGTCGCCGCCAAACCTGAGGACCAGTCTCATGCCATGACAGCCATCTACCT
GCCCGACAAGGTTACGATTCCAGACTTGCTGCCAAAGCTGCTGAGCAAGGGCATCATCTTCGCTGGCGGTATACA
TAAGGATATCGCCACCAAGTATATCCGATTTGGCCATATGGGCGTCACAGTGGTGAGCATACCGTTTTTGCCTCT
ATATTTGCGTGAATTGTGACTTATAAAGCTCGTTTTTGGTTAGGTCGATACCAAGCGAGACGATGTCGACAGGGC
AATTGAAGCTCTGAAGGCGGCGTTGGCTGAGTGCGGTTACAAGGGCGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail