Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2675
Gene name
LocationContig_189:7756..9196
Strand-
Gene length (bp)1440
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q753I3|DGK1_ASHGO CTP-dependent diacylglycerol kinase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DGK1 PE=3 SV=1 241 469 3.0E-52
sp|Q12382|DGK1_YEAST CTP-dependent diacylglycerol kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DGK1 PE=1 SV=1 184 478 4.0E-52
sp|P87170|DGK1_SCHPO CTP-dependent diacylglycerol kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptp4 PE=3 SV=1 238 467 4.0E-52

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 262 284 22
2 314 333 19
3 338 360 22
4 373 395 22
5 419 441 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2675
MVPRRLASDGCLLCTSHAARLTPVPAASSCHTTIATLDPRAAPADAADDGRPSPSRRLDLFASACALPRLSRHDT
ALLAAPPSLHRLVAGVACCPALPPIASTMSLRRRSNIPATPRVTSPSPTPSEHSAPGYCGPTTRSASAKHVATPD
TLTESAQDAHSSVLAAARPSRCRSRSPMNGHKPSRLTPNPSAKAAASSPSAQAGLDGRLAPPASTGWSWRDLSRS
PSPLGLIPIHRHWRTFVHKHEVPRKALHVSIGFFVVWLYTTGTQATSVTPCLMAALLPIATTDWLRHRYAPINRL
YVRLLGALMRETEYSGWNGVIFYLAGAWAVLYFLPKDVGTVSILLLSWCDTAASTFGRLWGRYTPRLRRGKSLAG
SLAAAIVGIMTCSFFYGWLVPTYGPQPGDQDFMFKGSLSLPTCIAQAVGIFGSLTGPMALGVLSLWSGFVASASE
VVDFFGLDDNLTIPVLSGIGIWGFLKLFT*
Coding >OphauB2|2675
ATGGTGCCTCGGAGGCTCGCATCCGACGGCTGTCTCTTGTGCACCAGCCATGCGGCGCGACTAACGCCCGTGCCC
GCTGCCTCATCCTGCCACACCACCATCGCTACCCTGGACCCTCGCGCTGCCCCCGCCGACGCCGCCGACGACGGC
CGGCCCAGCCCGAGTCGCAGGCTAGACTTGTTTGCGTCGGCCTGCGCCCTGCCACGGCTGTCGCGACACGACACG
GCCCTGCTGGCCGCCCCTCCCTCCCTCCATCGCCTCGTTGCTGGCGTCGCTTGCTGTCCCGCTCTCCCTCCAATT
GCCTCGACCATGTCGCTGCGCCGTCGCTCCAACATTCCCGCAACTCCGCGTGTCACGTCGCCCAGCCCGACCCCG
TCGGAGCATAGCGCCCCCGGGTATTGCGGTCCCACCACGCGTTCGGCCTCTGCAAAACACGTCGCAACCCCCGAT
ACCCTGACGGAGTCTGCTCAAGACGCACACTCCAGTGTCTTGGCAGCTGCTCGCCCATCGCGATGCCGCAGTCGC
TCGCCCATGAATGGCCACAAGCCGTCCCGCCTGACGCCCAATCCTTCAGCCAAAGCAGCGGCAAGCTCCCCTTCT
GCCCAGGCGGGCCTCGACGGCCGTCTGGCACCCCCAGCCTCTACCGGCTGGTCTTGGCGCGACTTGAGCCGTAGC
CCCAGCCCTCTGGGCCTCATTCCCATCCACAGGCACTGGCGGACCTTTGTGCACAAGCACGAGGTGCCGCGAAAG
GCCCTGCACGTCTCGATTGGCTTCTTTGTCGTCTGGCTCTACACCACCGGCACCCAGGCCACTTCGGTAACTCCC
TGTCTCATGGCGGCGCTCCTTCCAATCGCCACAACAGACTGGCTGAGGCATCGGTATGCTCCCATCAACCGGCTT
TATGTCAGGCTACTCGGCGCGCTCATGCGCGAGACGGAATACTCTGGCTGGAACGGTGTCATTTTTTACCTCGCG
GGCGCATGGGCTGTCCTCTACTTCTTGCCAAAGGACGTGGGCACCGTCAGCATCCTTCTTCTAAGCTGGTGTGAT
ACAGCAGCTAGCACTTTTGGCCGCCTCTGGGGTAGATACACGCCCAGGCTTCGTCGCGGCAAGTCTCTGGCAGGC
TCACTTGCTGCCGCCATTGTCGGCATCATGACATGCTCCTTCTTTTACGGCTGGCTCGTCCCCACCTATGGGCCT
CAGCCTGGAGACCAAGACTTCATGTTCAAGGGCAGCTTGTCACTGCCAACTTGTATTGCCCAAGCAGTCGGCATC
TTTGGAAGCCTAACGGGCCCTATGGCGCTCGGAGTTTTGAGTCTGTGGTCTGGCTTTGTGGCCTCTGCTAGCGAA
GTAGTAGACTTTTTCGGCCTCGACGACAATTTGACGATACCCGTCTTGAGCGGAATCGGCATCTGGGGATTTCTA
AAGCTTTTTACTTAG
Transcript >OphauB2|2675
ATGGTGCCTCGGAGGCTCGCATCCGACGGCTGTCTCTTGTGCACCAGCCATGCGGCGCGACTAACGCCCGTGCCC
GCTGCCTCATCCTGCCACACCACCATCGCTACCCTGGACCCTCGCGCTGCCCCCGCCGACGCCGCCGACGACGGC
CGGCCCAGCCCGAGTCGCAGGCTAGACTTGTTTGCGTCGGCCTGCGCCCTGCCACGGCTGTCGCGACACGACACG
GCCCTGCTGGCCGCCCCTCCCTCCCTCCATCGCCTCGTTGCTGGCGTCGCTTGCTGTCCCGCTCTCCCTCCAATT
GCCTCGACCATGTCGCTGCGCCGTCGCTCCAACATTCCCGCAACTCCGCGTGTCACGTCGCCCAGCCCGACCCCG
TCGGAGCATAGCGCCCCCGGGTATTGCGGTCCCACCACGCGTTCGGCCTCTGCAAAACACGTCGCAACCCCCGAT
ACCCTGACGGAGTCTGCTCAAGACGCACACTCCAGTGTCTTGGCAGCTGCTCGCCCATCGCGATGCCGCAGTCGC
TCGCCCATGAATGGCCACAAGCCGTCCCGCCTGACGCCCAATCCTTCAGCCAAAGCAGCGGCAAGCTCCCCTTCT
GCCCAGGCGGGCCTCGACGGCCGTCTGGCACCCCCAGCCTCTACCGGCTGGTCTTGGCGCGACTTGAGCCGTAGC
CCCAGCCCTCTGGGCCTCATTCCCATCCACAGGCACTGGCGGACCTTTGTGCACAAGCACGAGGTGCCGCGAAAG
GCCCTGCACGTCTCGATTGGCTTCTTTGTCGTCTGGCTCTACACCACCGGCACCCAGGCCACTTCGGTAACTCCC
TGTCTCATGGCGGCGCTCCTTCCAATCGCCACAACAGACTGGCTGAGGCATCGGTATGCTCCCATCAACCGGCTT
TATGTCAGGCTACTCGGCGCGCTCATGCGCGAGACGGAATACTCTGGCTGGAACGGTGTCATTTTTTACCTCGCG
GGCGCATGGGCTGTCCTCTACTTCTTGCCAAAGGACGTGGGCACCGTCAGCATCCTTCTTCTAAGCTGGTGTGAT
ACAGCAGCTAGCACTTTTGGCCGCCTCTGGGGTAGATACACGCCCAGGCTTCGTCGCGGCAAGTCTCTGGCAGGC
TCACTTGCTGCCGCCATTGTCGGCATCATGACATGCTCCTTCTTTTACGGCTGGCTCGTCCCCACCTATGGGCCT
CAGCCTGGAGACCAAGACTTCATGTTCAAGGGCAGCTTGTCACTGCCAACTTGTATTGCCCAAGCAGTCGGCATC
TTTGGAAGCCTAACGGGCCCTATGGCGCTCGGAGTTTTGAGTCTGTGGTCTGGCTTTGTGGCCTCTGCTAGCGAA
GTAGTAGACTTTTTCGGCCTCGACGACAATTTGACGATACCCGTCTTGAGCGGAATCGGCATCTGGGGATTTCTA
AAGCTTTTTACTTAG
Gene >OphauB2|2675
ATGGTGCCTCGGAGGCTCGCATCCGACGGCTGTCTCTTGTGCACCAGCCATGCGGCGCGACTAACGCCCGTGCCC
GCTGCCTCATCCTGCCACACCACCATCGCTACCCTGGACCCTCGCGCTGCCCCCGCCGACGCCGCCGACGACGGC
CGGCCCAGCCCGAGTCGCAGGCTAGACTTGTTTGCGTCGGCCTGCGCCCTGCCACGGCTGTCGCGACACGACACG
GCCCTGCTGGCCGCCCCTCCCTCCCTCCATCGCCTCGTTGCTGGCGTCGCTTGCTGTCCCGCTCTCCCTCCAATT
GCCTCGACCATGTCGCTGCGCCGTCGCTCCAACATTCCCGCAACTCCGCGTGTCACGTCGCCCAGCCCGACCCCG
TCGGAGCATAGCGCCCCCGGGTATTGCGGTCCCACCACGCGTTCGGCCTCTGCAAAACACGTCGCAACCCCCGAT
ACCCTGACGGAGTCTGCTCAAGACGCACACTCCAGTGTCTTGGCAGCTGCTCGCCCATCGCGATGCCGCAGTCGC
TCGCCCATGAATGGCCACAAGCCGTCCCGCCTGACGCCCAATCCTTCAGCCAAAGCAGCGGCAAGCTCCCCTTCT
GCCCAGGCGGGCCTCGACGGCCGTCTGGCACCCCCAGCCTCTACCGGCTGGTCTTGGCGCGACTTGAGCCGTAGC
CCCAGCCCTCTGGGCCTCATTCCCATCCACAGGCACTGGCGGACCTTTGTGCACAAGCACGAGGTGCCGCGAAAG
GCCCTGCACGTCTCGATTGGCTTCTTTGTCGTCTGGCTCTACACCACCGGCACCCAGGCCACTTCGGTAACTCCC
TGTCTCATGGCGGCGCTCCTTCCAATCGCCACAACAGACTGGCTGAGGCATCGGTATGCTCCCATCAACCGGCTT
TATGTCAGGCTACTCGGCGCGCTCATGCGCGAGACGGAATACTCTGGCTGGAACGGTGTCATTTTTTACCTCGCG
GGCGCATGGGCTGTCCTCTACTTCTTGCCAAAGGACGTGGGCACCGTCAGCATCCTTCTTCTAAGCTGGTGTGAT
ACAGCAGCTAGCACTTTTGGCCGCCTCTGGGGTAGATACACGCCCAGGCTTCGTCGCGGCAAGTCTCTGGCAGGC
TCACTTGCTGCCGCCATTGTCGGCATCATGACATGCTCCTTCTTTTACGGCTGGCTCGTCCCCACCTATGGGCCT
CAGCCTGGAGACCAAGACTTCATGTTCAAGGGCAGCTTGTCACTGCCAACTTGTATTGCCCAAGCAGTCGGCATC
TTTGGAAGCCTAACGGGCCCTATGGCGCTCGGAGTTTTGAGTCTGTGGTCTGGCTTTGTGGCCTCTGCTAGCGAA
GTAGTAGACTTTTTCGGCCTCGACGACAATTTGACGATACCCGTCTTGAGCGGAATCGGCATCTGGGGATTTCTA
AAGCTTTTTACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail