Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2674
Gene name
LocationContig_189:3651..4377
Strand-
Gene length (bp)726
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10241 KxDL Uncharacterized conserved protein 1.3E-31 87 172

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q755A2|KXD1_ASHGO Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KXD1 PE=3 SV=1 41 178 2.0E-10
sp|Q6CMK9|KXD1_KLULA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KXD1 PE=3 SV=1 79 178 3.0E-10
sp|Q6FS55|KXD1_CANGA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KXD1 PE=3 SV=1 70 179 2.0E-08
sp|C5E000|KXD1_ZYGRC Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KXD1 PE=3 SV=1 78 179 7.0E-07
sp|E7LUC9|KXD1_YEASV Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q755A2|KXD1_ASHGO Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KXD1 PE=3 SV=1 41 178 2.0E-10
sp|Q6CMK9|KXD1_KLULA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KXD1 PE=3 SV=1 79 178 3.0E-10
sp|Q6FS55|KXD1_CANGA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KXD1 PE=3 SV=1 70 179 2.0E-08
sp|C5E000|KXD1_ZYGRC Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KXD1 PE=3 SV=1 78 179 7.0E-07
sp|E7LUC9|KXD1_YEASV Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|P53158|KXD1_YEAST Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KXD1 PE=1 SV=1 79 179 7.0E-06
sp|E7NHM9|KXD1_YEASO Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain FostersO) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|E7KNF7|KXD1_YEASL Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|E7KCH3|KXD1_YEASA Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain AWRI796) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|C8Z8G8|KXD1_YEAS8 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|A6ZUA0|KXD1_YEAS7 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain YJM789) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|B5VIP5|KXD1_YEAS6 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|B3LHE5|KXD1_YEAS1 Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
sp|E7Q3U6|KXD1_YEASB Biogenesis of lysosome-related organelles complex 1 subunit KXD1 OS=Saccharomyces cerevisiae (strain FostersB) GN=KXD1 PE=3 SV=1 79 179 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2674
MSGPYSAAPYSMPMAVPPKGNQYPTFTQYSLSPPESEDSISSASGVASYSNSGFSASCSSYMGSSSADFDSSGSA
SGVDFQEYMQERFANSFNPIPLDRSMAVQAQTSGKLNAKHRELLDLQKQAQARLAKTRERFQEGMRDAREVRADL
EWTQKKVCALQVKAARKHPKEYAKARARYPSPEC*
Coding >OphauB2|2674
ATGTCTGGCCCCTACTCAGCTGCCCCATACTCCATGCCCATGGCTGTCCCACCAAAGGGGAACCAGTATCCCACA
TTCACTCAGTATTCTCTCTCGCCTCCAGAGAGCGAAGACTCAATCAGCTCTGCATCTGGTGTCGCTTCATATAGC
AACAGTGGATTCTCAGCCTCCTGTAGCAGCTACATGGGCAGCTCTAGTGCAGATTTCGACAGCAGCGGCTCTGCT
AGCGGCGTCGACTTCCAGGAATACATGCAGGAGCGCTTTGCCAATTCATTCAATCCTATTCCACTCGATCGCAGT
ATGGCGGTTCAAGCACAGACTTCGGGAAAACTCAATGCCAAGCATCGAGAGCTTCTTGACCTGCAAAAGCAGGCC
CAGGCGCGTCTCGCCAAGACTCGTGAGCGCTTCCAAGAAGGCATGCGCGATGCCCGCGAGGTGCGAGCAGATCTT
GAATGGACGCAGAAGAAGGTTTGCGCGCTTCAAGTAAAAGCTGCCCGGAAGCATCCTAAGGAATACGCAAAAGCT
CGGGCGAGATACCCTTCTCCAGAATGTTGA
Transcript >OphauB2|2674
ATGTCTGGCCCCTACTCAGCTGCCCCATACTCCATGCCCATGGCTGTCCCACCAAAGGGGAACCAGTATCCCACA
TTCACTCAGTATTCTCTCTCGCCTCCAGAGAGCGAAGACTCAATCAGCTCTGCATCTGGTGTCGCTTCATATAGC
AACAGTGGATTCTCAGCCTCCTGTAGCAGCTACATGGGCAGCTCTAGTGCAGATTTCGACAGCAGCGGCTCTGCT
AGCGGCGTCGACTTCCAGGAATACATGCAGGAGCGCTTTGCCAATTCATTCAATCCTATTCCACTCGATCGCAGT
ATGGCGGTTCAAGCACAGACTTCGGGAAAACTCAATGCCAAGCATCGAGAGCTTCTTGACCTGCAAAAGCAGGCC
CAGGCGCGTCTCGCCAAGACTCGTGAGCGCTTCCAAGAAGGCATGCGCGATGCCCGCGAGGTGCGAGCAGATCTT
GAATGGACGCAGAAGAAGGTTTGCGCGCTTCAAGTAAAAGCTGCCCGGAAGCATCCTAAGGAATACGCAAAAGCT
CGGGCGAGATACCCTTCTCCAGAATGTTGA
Gene >OphauB2|2674
ATGTCTGGCCCCTACTCAGCTGCCCCATACTCCATGCCCATGGCTGTCCCACCAAAGGGGAACCAGTATCCCACA
TTCACTCAGTATTCTCTCTCGCCTCCAGAGAGCGAAGACTCAATCAGCTCTGCATCTGGTGTCGCTTCATATAGC
AACAGTGGATTCTCAGCCTCCTGTAGCAGCTACATGGGCAGCTCTAGTGCAGATTTCGACAGCAGCGGCTCTGCT
AGCGGCGTCGACTTCCAGGAATACATGCAGGAGCGCTTTGCCAATTCATTCAATCCTATTCCACTCGATCGCAGT
ATGGCGGTTCAAGCACAGACGTAAGTCAGACACCCTCAGATATCCACTCCCAAACCCATCCGGCAAGCCAGTTCC
CAGTCTTGACCGTGTCCATGTAGTTCGGGAAAACTCAATGCCAAGCATCGAGAGCTTCTTGACCTGCAAAAGCAG
GCCCAGGCGCGTCTCGCCAAGACTCGTGAGCGCTTCCAAGAAGGCATGCGCGATGCCCGCGAGGTGCGAGCAGAT
CTTGAATGGACGCAGAAGAAGGTTTGGTAAGTCTCGATTAGTAACTAATTTCCCACCGTGCTCCGCTCCATGTCT
TGGGTGTTGAAGAGCAATTTTCGGCTAATAGTGCTTTGTTGTAGCGCGCTTCAAGTAAAAGCTGCCCGGAAGCAT
CCTAAGGAATACGCAAAAGCTCGGGCGAGATACCCTTCTCCAGAATGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail