Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2660
Gene name
LocationContig_188:7456..8405
Strand-
Gene length (bp)949
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 1.6E-07 178 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW5|YFW6_SCHPO UPF0644 protein PB2B4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB2B4.06 PE=3 SV=2 92 277 3.0E-23
sp|P53716|YBJ5_CANAW Uncharacterized protein CAWG_04269, mitochondrial OS=Candida albicans (strain WO-1) GN=CAWG_04269 PE=2 SV=2 100 272 6.0E-21
sp|O74793|YOUB_SCHPO Uncharacterized protein C26H8.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.11c PE=4 SV=1 157 271 2.0E-18
sp|P38172|MRX3_YEAST MIOREX complex component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX3 PE=1 SV=1 104 249 8.0E-15
sp|Q566R0|THEM4_RAT Acyl-coenzyme A thioesterase THEM4 OS=Rattus norvegicus GN=Them4 PE=2 SV=1 152 269 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW5|YFW6_SCHPO UPF0644 protein PB2B4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB2B4.06 PE=3 SV=2 92 277 3.0E-23
sp|P53716|YBJ5_CANAW Uncharacterized protein CAWG_04269, mitochondrial OS=Candida albicans (strain WO-1) GN=CAWG_04269 PE=2 SV=2 100 272 6.0E-21
sp|O74793|YOUB_SCHPO Uncharacterized protein C26H8.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.11c PE=4 SV=1 157 271 2.0E-18
sp|P38172|MRX3_YEAST MIOREX complex component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX3 PE=1 SV=1 104 249 8.0E-15
sp|Q566R0|THEM4_RAT Acyl-coenzyme A thioesterase THEM4 OS=Rattus norvegicus GN=Them4 PE=2 SV=1 152 269 2.0E-14
sp|Q3UUI3|THEM4_MOUSE Acyl-coenzyme A thioesterase THEM4 OS=Mus musculus GN=Them4 PE=1 SV=1 152 269 8.0E-14
sp|Q5T1C6|THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens GN=THEM4 PE=1 SV=1 152 269 6.0E-12
sp|A1A4L1|THEM4_BOVIN Acyl-coenzyme A thioesterase THEM4 OS=Bos taurus GN=THEM4 PE=2 SV=1 153 269 3.0E-09
sp|P40098|FMP10_YEAST Uncharacterized mitochondrial membrane protein FMP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP10 PE=1 SV=1 14 253 4.0E-08
sp|Q6GLK2|THEM4_XENLA Acyl-coenzyme A thioesterase THEM4 OS=Xenopus laevis GN=them4 PE=2 SV=2 152 269 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2660
MITRRQVGRGAWRLAQRQSQSRGQSYTTATREAAAASKSQARKWGAGSIAGLALFGVASGSVGAAAAWKTLRAQG
LGFYSDEESLSRYSVPDDDAEARRVYQAIEAHPLVAELRQRPNLTESRPHVKMPAAFRRQSLTGNALSGPRRVPV
PAIAWNEADGKSVTLIVYVGDELCGHPGLVHGGFLATLLDEGLAWCCFAALPHGIGVTARLAIDYRKPTPANSLL
VLRGETVKVEGRKAWVKGSVELLPQAGDEGKEPVVVAEAEALYVSPRHAAMMPRLR*
Coding >OphauB2|2660
ATGATTACGCGACGGCAGGTCGGACGCGGCGCATGGCGGCTAGCACAGCGGCAGAGTCAGAGTCGAGGCCAAAGC
TACACGACGGCTACACGCGAGGCAGCAGCAGCAAGCAAGAGCCAGGCGCGAAAATGGGGCGCAGGCTCGATTGCT
GGGCTGGCTCTCTTTGGAGTGGCATCAGGCAGCGTGGGCGCAGCAGCGGCATGGAAGACGCTGAGGGCGCAGGGC
CTGGGATTTTATTCCGACGAGGAGAGCCTCTCGCGATACTCGGTGCCCGACGACGACGCCGAGGCGCGACGCGTC
TACCAAGCCATTGAGGCGCACCCCCTAGTGGCGGAGCTGCGGCAACGACCCAACCTCACCGAGTCGCGACCTCAT
GTCAAGATGCCGGCCGCATTCCGCCGCCAAAGCCTCACGGGCAACGCCCTCTCAGGCCCCCGGCGCGTGCCAGTG
CCAGCCATTGCGTGGAACGAAGCCGACGGCAAGTCGGTGACGCTAATCGTCTATGTGGGCGACGAGCTCTGCGGC
CACCCTGGCCTGGTGCACGGCGGCTTCTTGGCAACGCTGCTGGACGAGGGCCTGGCCTGGTGCTGCTTTGCCGCG
CTGCCTCATGGCATTGGCGTGACGGCGCGGCTGGCCATTGACTACCGCAAGCCGACGCCTGCGAATAGCTTGCTG
GTGCTGAGGGGGGAGACGGTAAAGGTGGAGGGGAGAAAGGCCTGGGTAAAGGGCAGCGTAGAGCTTTTGCCCCAG
GCGGGCGACGAGGGCAAGGAGCCCGTCGTGGTGGCCGAGGCGGAAGCCTTGTATGTGTCGCCTCGACATGCAGCC
ATGATGCCGCGTCTTCGCTAA
Transcript >OphauB2|2660
ATGATTACGCGACGGCAGGTCGGACGCGGCGCATGGCGGCTAGCACAGCGGCAGAGTCAGAGTCGAGGCCAAAGC
TACACGACGGCTACACGCGAGGCAGCAGCAGCAAGCAAGAGCCAGGCGCGAAAATGGGGCGCAGGCTCGATTGCT
GGGCTGGCTCTCTTTGGAGTGGCATCAGGCAGCGTGGGCGCAGCAGCGGCATGGAAGACGCTGAGGGCGCAGGGC
CTGGGATTTTATTCCGACGAGGAGAGCCTCTCGCGATACTCGGTGCCCGACGACGACGCCGAGGCGCGACGCGTC
TACCAAGCCATTGAGGCGCACCCCCTAGTGGCGGAGCTGCGGCAACGACCCAACCTCACCGAGTCGCGACCTCAT
GTCAAGATGCCGGCCGCATTCCGCCGCCAAAGCCTCACGGGCAACGCCCTCTCAGGCCCCCGGCGCGTGCCAGTG
CCAGCCATTGCGTGGAACGAAGCCGACGGCAAGTCGGTGACGCTAATCGTCTATGTGGGCGACGAGCTCTGCGGC
CACCCTGGCCTGGTGCACGGCGGCTTCTTGGCAACGCTGCTGGACGAGGGCCTGGCCTGGTGCTGCTTTGCCGCG
CTGCCTCATGGCATTGGCGTGACGGCGCGGCTGGCCATTGACTACCGCAAGCCGACGCCTGCGAATAGCTTGCTG
GTGCTGAGGGGGGAGACGGTAAAGGTGGAGGGGAGAAAGGCCTGGGTAAAGGGCAGCGTAGAGCTTTTGCCCCAG
GCGGGCGACGAGGGCAAGGAGCCCGTCGTGGTGGCCGAGGCGGAAGCCTTGTATGTGTCGCCTCGACATGCAGCC
ATGATGCCGCGTCTTCGCTAA
Gene >OphauB2|2660
ATGATTACGCGACGGCAGGTCGGACGCGGCGCATGGCGGCTAGCACAGCGGCAGAGTCAGAGTCGAGGCCAAAGC
TACACGACGGCTACACGCGAGGCAGCAGCAGCAAGCAAGAGCCAGGCGCGAAAATGGGGCGCAGGCTCGATTGCT
GGGCTGGCTCTCTTTGGAGTGGCATCAGGCAGCGTGGGCGCAGCAGCGGCATGGAAGACGCTGAGGGCGCAGGGC
CTGGGATTTTATTCCGACGAGGAGAGCCTCTCGCGATACTCGGTGCCCGACGACGACGCCGAGGCGCGACGCGTC
TACCAAGCCATTGAGGCGCACCCCCTAGTGGCGGAGCTGCGGCAACGACCCAACCTCACCGAGTCGCGACCTCAT
GTCAAGATGCCGGCCGCATTCCGCCGCCAAAGCCTCACGGGCAACGCCCTCTCAGGCCCCCGGCGCGTGCCAGTG
CCAGCCATTGCGTGGAACGAAGCCGACGGCAAGTCGGTGACGCTAATCGTCTATGTGGGCGACGAGCTCTGCGGC
CACCCTGGCCTGGTGCACGGCGGCTTCTTGGCAACGCTGCTGGACGAGGGCCTGGCCTGGTGCTGCTTTGCCGCG
CTGCCTCATGGCATTGGCGTGACGGCGCGGCTGGCCATTGACTACCGCAAGCCGACGCCTGCGAATAGCTTGCTG
GTGCTGAGGGGGGAGACGGTAAAGGTGGAGGGGAGAAAGGCCTGGGTAAAGGGCAGCGTAGAGCTTTTGCCCCAG
GCGGGCGACGAGGGCAAGGAGCCCGTCGTGGTGGCCGAGGCGGAAGCCTTGTATGTGTCGCCTCGACATGCAGCC
GTGAGTTTTTTTTTTTTTTTTTTTTTTTTTCCTCTCGTCTCTACAATTTATTATTATCATTTCTGCATTTATTTG
CTAATGGACCGACGGTCATGGCCTCTAGATGATGCCGCGTCTTCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail