Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2653
Gene name
LocationContig_187:21356..24151
Strand-
Gene length (bp)2795
Transcript length (bp)2517
Coding sequence length (bp)2517
Protein length (aa) 839

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 8.5E-08 230 280
PF01846 FF FF domain 1.8E-10 376 429
PF00397 WW WW domain 6.5E-10 18 44
PF00397 WW WW domain 3.5E-07 59 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14176|PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp40 PE=1 SV=1 6 569 9.0E-96
sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 17 556 9.0E-49
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 158 566 7.0E-40
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 16 577 1.0E-39
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 158 566 1.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14176|PRP40_SCHPO Pre-mRNA-processing protein prp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp40 PE=1 SV=1 6 569 9.0E-96
sp|P33203|PRP40_YEAST Pre-mRNA-processing protein PRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP40 PE=1 SV=1 17 556 9.0E-49
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 158 566 7.0E-40
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 16 577 1.0E-39
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 158 566 1.0E-39
sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1 155 584 1.0E-35
sp|P34600|YO61_CAEEL WW domain-containing protein ZK1098.1 OS=Caenorhabditis elegans GN=ZK1098.1 PE=1 SV=2 5 521 9.0E-34
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 158 655 1.0E-26
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 11 105 7.0E-17
sp|O75400|PR40A_HUMAN Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens GN=PRPF40A PE=1 SV=2 9 94 2.0E-16
sp|B6EUA9|PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana GN=PRP40A PE=1 SV=1 12 91 3.0E-16
sp|Q9R1C7|PR40A_MOUSE Pre-mRNA-processing factor 40 homolog A OS=Mus musculus GN=Prpf40a PE=1 SV=1 19 94 5.0E-16
sp|Q6NWY9|PR40B_HUMAN Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens GN=PRPF40B PE=1 SV=1 10 85 5.0E-14
sp|Q80W14|PR40B_MOUSE Pre-mRNA-processing factor 40 homolog B OS=Mus musculus GN=Prpf40b PE=1 SV=2 10 85 1.0E-13
sp|Q5HZF2|WBP4_RAT WW domain-binding protein 4 OS=Rattus norvegicus GN=Wbp4 PE=2 SV=1 19 88 1.0E-11
sp|Q61048|WBP4_MOUSE WW domain-binding protein 4 OS=Mus musculus GN=Wbp4 PE=1 SV=4 18 88 3.0E-11
sp|Q5F457|WBP4_CHICK WW domain-binding protein 4 OS=Gallus gallus GN=WBP4 PE=2 SV=1 12 88 3.0E-10
sp|O75554|WBP4_HUMAN WW domain-binding protein 4 OS=Homo sapiens GN=WBP4 PE=1 SV=1 19 88 4.0E-09
sp|Q6PGZ3|MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio GN=traf3ip1 PE=2 SV=1 670 720 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4277
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7011
Ophiocordyceps australis map64 (Brazil) OphauB2|2653 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07132
Ophiocordyceps camponoti-rufipedis Ophun1|7204
Ophiocordyceps kimflemingae Ophio5|3992
Ophiocordyceps subramaniannii Hirsu2|8741

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2653
MNGFPGPYGGPPQSPASAWQEHHTPDGRAYYYNATTKVTQWTKPEDLMGLAERALANQPWKEYTAEGGRKYWYNT
ETKQSSWEMPDIFKNALTASDGRSAVGPPAAYAQPHQHQQSQSYGAPNRYGPRDQGRGGRDALSDGRQLSRSFVP
ASDIGAEYSSKEEAVGAFTKALRRFGVQPDWAWEKVMKTVGKDAHFQAIKHPKLRRDTFAKYCEDLLRQEEERAK
ERLSKLRADFEIMLKRHPEITHFTRWKTARPMIEGETIFRSTDNEQERRLLFDEYIASLRQAYQDKVKAQRNTAL
QALKDMLPKLDITAYTRWADGRNTIKAAIDDDGKFTVLTMSEILGAFQEHAKALERSLNEKRQHDKKMKYRKERC
NRDAFKSLLGQLRRDGHIKAGTKWSDLYPLLENDERYLDMLGQDGSSPLSLFRDLVEEEERALRGPRNDVLDVLE
DKRFVLTPSTAFDDFVALLKDDRRTESIDASVLQLIFDRLREKRAAKHQDEKHNSERNHRHAMDNVRLCMKRLEP
PISLGDSYESVRSRLSQTAELETVGSEDAVRHAFDRHMRRLRDKADEGSDRRHHRRNSHTSRTSRLSSEREMPRR
ARERERDRSRGERSHRGGRPSRRSRSPEPDPYEADRRRAVAERERNHRKSAMAENVLSGERARLSPPPRRERERD
RDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDYDRYARSRRSDDSSFARDRRERENGLADRPLRRPIDNRS
VDELNYGDERPSSALGSRRRRPSDSDGLQRAKDSRDAKRVKLDPALDSSPSQRSARGRNKSPPAAAAVSAIKEAR
DIRSGSEEGEIEE*
Coding >OphauB2|2653
ATGAACGGGTTTCCCGGTCCGTATGGAGGCCCGCCACAGTCGCCAGCCTCGGCCTGGCAAGAACATCACACGCCC
GATGGCCGAGCCTACTACTACAATGCGACGACCAAGGTGACGCAATGGACCAAGCCTGAGGATCTCATGGGCCTA
GCCGAGCGCGCCTTGGCCAACCAGCCATGGAAGGAATATACGGCCGAAGGAGGAAGGAAGTATTGGTACAATACC
GAGACTAAGCAGAGCTCTTGGGAGATGCCAGACATCTTCAAAAACGCTCTCACTGCCAGTGACGGCCGCAGTGCC
GTTGGGCCCCCAGCTGCCTACGCCCAACCACACCAACACCAACAGTCTCAGAGCTATGGCGCGCCAAATCGCTAT
GGGCCGCGCGATCAAGGCCGCGGTGGTCGCGATGCCTTGTCAGATGGCAGACAGCTCTCGCGATCTTTTGTCCCA
GCCTCGGACATTGGCGCCGAGTATTCGTCCAAGGAAGAGGCCGTGGGAGCCTTCACCAAGGCATTGCGTCGGTTC
GGCGTCCAGCCCGACTGGGCTTGGGAAAAGGTGATGAAGACGGTTGGCAAAGACGCTCACTTCCAGGCAATCAAG
CATCCCAAGCTCCGCCGCGACACATTTGCCAAGTACTGCGAGGACCTGCTGCGCCAGGAAGAGGAGAGAGCCAAG
GAAAGGCTATCCAAGCTACGCGCCGACTTTGAAATCATGCTCAAGAGGCACCCAGAAATCACGCACTTTACCCGG
TGGAAGACAGCCCGGCCCATGATTGAGGGCGAAACCATATTCCGCTCCACAGACAATGAGCAAGAGCGCCGATTG
CTATTTGACGAGTACATTGCTAGCCTCAGGCAAGCCTACCAAGACAAGGTCAAGGCTCAACGCAACACGGCTTTG
CAGGCACTCAAGGACATGTTGCCCAAGCTCGACATCACTGCATATACGCGGTGGGCCGATGGACGAAACACCATC
AAGGCCGCCATTGACGACGACGGCAAGTTTACAGTGCTAACAATGTCTGAGATTCTCGGTGCCTTTCAGGAACAC
GCCAAAGCTCTCGAGAGAAGCCTCAACGAAAAGAGACAGCACGATAAAAAGATGAAGTATCGTAAAGAGCGTTGC
AATCGCGATGCCTTCAAGTCCTTACTCGGCCAGCTGCGTAGAGACGGCCACATCAAGGCAGGGACCAAATGGTCC
GACTTGTACCCCCTGCTTGAAAACGACGAGCGCTATCTCGACATGCTAGGCCAAGACGGCTCCAGCCCTCTCTCG
CTATTCCGCGATCTAGTCGAGGAAGAGGAACGGGCATTGCGTGGTCCTCGCAACGATGTCCTCGACGTACTAGAA
GATAAGCGCTTCGTACTGACACCGTCGACCGCCTTCGATGATTTTGTAGCACTTCTCAAGGACGACCGTCGCACC
GAAAGCATTGACGCCTCGGTTCTGCAACTCATTTTTGACAGACTTCGAGAGAAGCGAGCAGCTAAACACCAAGAT
GAAAAGCACAACAGCGAACGGAACCATCGTCACGCAATGGACAATGTGCGTCTATGTATGAAGAGGCTTGAGCCT
CCAATATCCTTGGGCGACTCATACGAGAGTGTGCGGTCACGTCTATCCCAGACAGCAGAGCTCGAGACGGTTGGC
TCGGAAGATGCTGTTCGACATGCCTTTGACCGCCACATGCGTCGGCTCAGGGACAAGGCGGATGAGGGCTCTGAT
CGTCGCCACCACCGCCGCAACAGCCACACCAGCCGCACCAGCCGCTTGTCGAGCGAGAGAGAGATGCCACGCCGT
GCTCGTGAGCGTGAGCGTGATCGGTCGCGTGGAGAGCGCTCTCATCGGGGGGGACGGCCCTCGCGCCGCAGCCGC
AGCCCCGAGCCTGATCCTTACGAGGCTGATAGGCGAAGGGCTGTGGCGGAGCGGGAGCGCAATCATCGCAAGTCA
GCCATGGCTGAGAATGTACTGTCTGGTGAGCGCGCGCGACTGAGCCCTCCGCCGCGACGGGAGCGGGAGCGAGAC
CGTGACCGTGACCGGGATCGGGATCGGGATCGGGATCGTGACCGCGACCGCGACCGTGACCGCGACCGGGACCGT
GATCGCGACCGCGATAGGGATAGAGAACGAGACTATGATCGCTACGCCCGTTCCCGCCGCAGCGATGACTCGTCT
TTTGCGCGTGATCGTCGCGAGCGCGAAAACGGCTTGGCCGATCGGCCCCTGCGCCGCCCCATTGATAACCGCTCT
GTCGATGAGCTCAACTATGGCGACGAGCGGCCCTCATCTGCCCTTGGCTCTCGCCGCCGCCGCCCAAGCGACAGC
GATGGCCTCCAGCGTGCCAAGGACTCACGCGATGCCAAACGCGTCAAATTGGATCCAGCATTGGATTCGAGTCCA
TCACAGCGCTCAGCCAGAGGACGAAACAAGTCTCCTCCTGCCGCCGCCGCCGTCTCTGCTATTAAGGAAGCCAGA
GACATTCGCAGCGGTAGTGAGGAAGGCGAAATAGAGGAATAG
Transcript >OphauB2|2653
ATGAACGGGTTTCCCGGTCCGTATGGAGGCCCGCCACAGTCGCCAGCCTCGGCCTGGCAAGAACATCACACGCCC
GATGGCCGAGCCTACTACTACAATGCGACGACCAAGGTGACGCAATGGACCAAGCCTGAGGATCTCATGGGCCTA
GCCGAGCGCGCCTTGGCCAACCAGCCATGGAAGGAATATACGGCCGAAGGAGGAAGGAAGTATTGGTACAATACC
GAGACTAAGCAGAGCTCTTGGGAGATGCCAGACATCTTCAAAAACGCTCTCACTGCCAGTGACGGCCGCAGTGCC
GTTGGGCCCCCAGCTGCCTACGCCCAACCACACCAACACCAACAGTCTCAGAGCTATGGCGCGCCAAATCGCTAT
GGGCCGCGCGATCAAGGCCGCGGTGGTCGCGATGCCTTGTCAGATGGCAGACAGCTCTCGCGATCTTTTGTCCCA
GCCTCGGACATTGGCGCCGAGTATTCGTCCAAGGAAGAGGCCGTGGGAGCCTTCACCAAGGCATTGCGTCGGTTC
GGCGTCCAGCCCGACTGGGCTTGGGAAAAGGTGATGAAGACGGTTGGCAAAGACGCTCACTTCCAGGCAATCAAG
CATCCCAAGCTCCGCCGCGACACATTTGCCAAGTACTGCGAGGACCTGCTGCGCCAGGAAGAGGAGAGAGCCAAG
GAAAGGCTATCCAAGCTACGCGCCGACTTTGAAATCATGCTCAAGAGGCACCCAGAAATCACGCACTTTACCCGG
TGGAAGACAGCCCGGCCCATGATTGAGGGCGAAACCATATTCCGCTCCACAGACAATGAGCAAGAGCGCCGATTG
CTATTTGACGAGTACATTGCTAGCCTCAGGCAAGCCTACCAAGACAAGGTCAAGGCTCAACGCAACACGGCTTTG
CAGGCACTCAAGGACATGTTGCCCAAGCTCGACATCACTGCATATACGCGGTGGGCCGATGGACGAAACACCATC
AAGGCCGCCATTGACGACGACGGCAAGTTTACAGTGCTAACAATGTCTGAGATTCTCGGTGCCTTTCAGGAACAC
GCCAAAGCTCTCGAGAGAAGCCTCAACGAAAAGAGACAGCACGATAAAAAGATGAAGTATCGTAAAGAGCGTTGC
AATCGCGATGCCTTCAAGTCCTTACTCGGCCAGCTGCGTAGAGACGGCCACATCAAGGCAGGGACCAAATGGTCC
GACTTGTACCCCCTGCTTGAAAACGACGAGCGCTATCTCGACATGCTAGGCCAAGACGGCTCCAGCCCTCTCTCG
CTATTCCGCGATCTAGTCGAGGAAGAGGAACGGGCATTGCGTGGTCCTCGCAACGATGTCCTCGACGTACTAGAA
GATAAGCGCTTCGTACTGACACCGTCGACCGCCTTCGATGATTTTGTAGCACTTCTCAAGGACGACCGTCGCACC
GAAAGCATTGACGCCTCGGTTCTGCAACTCATTTTTGACAGACTTCGAGAGAAGCGAGCAGCTAAACACCAAGAT
GAAAAGCACAACAGCGAACGGAACCATCGTCACGCAATGGACAATGTGCGTCTATGTATGAAGAGGCTTGAGCCT
CCAATATCCTTGGGCGACTCATACGAGAGTGTGCGGTCACGTCTATCCCAGACAGCAGAGCTCGAGACGGTTGGC
TCGGAAGATGCTGTTCGACATGCCTTTGACCGCCACATGCGTCGGCTCAGGGACAAGGCGGATGAGGGCTCTGAT
CGTCGCCACCACCGCCGCAACAGCCACACCAGCCGCACCAGCCGCTTGTCGAGCGAGAGAGAGATGCCACGCCGT
GCTCGTGAGCGTGAGCGTGATCGGTCGCGTGGAGAGCGCTCTCATCGGGGGGGACGGCCCTCGCGCCGCAGCCGC
AGCCCCGAGCCTGATCCTTACGAGGCTGATAGGCGAAGGGCTGTGGCGGAGCGGGAGCGCAATCATCGCAAGTCA
GCCATGGCTGAGAATGTACTGTCTGGTGAGCGCGCGCGACTGAGCCCTCCGCCGCGACGGGAGCGGGAGCGAGAC
CGTGACCGTGACCGGGATCGGGATCGGGATCGGGATCGTGACCGCGACCGCGACCGTGACCGCGACCGGGACCGT
GATCGCGACCGCGATAGGGATAGAGAACGAGACTATGATCGCTACGCCCGTTCCCGCCGCAGCGATGACTCGTCT
TTTGCGCGTGATCGTCGCGAGCGCGAAAACGGCTTGGCCGATCGGCCCCTGCGCCGCCCCATTGATAACCGCTCT
GTCGATGAGCTCAACTATGGCGACGAGCGGCCCTCATCTGCCCTTGGCTCTCGCCGCCGCCGCCCAAGCGACAGC
GATGGCCTCCAGCGTGCCAAGGACTCACGCGATGCCAAACGCGTCAAATTGGATCCAGCATTGGATTCGAGTCCA
TCACAGCGCTCAGCCAGAGGACGAAACAAGTCTCCTCCTGCCGCCGCCGCCGTCTCTGCTATTAAGGAAGCCAGA
GACATTCGCAGCGGTAGTGAGGAAGGCGAAATAGAGGAATAG
Gene >OphauB2|2653
ATGAACGGGTTTCCCGGTCCGTATGGAGGCCCGCCACAGTCGCCAGCCTCGGCCTGGCAAGAACATCACACGCCC
GATGGCCGAGCCTACTACTACAATGCGACGACCAAGGTGACGCAATGGACCAAGCCTGAGGATCTCATGGGCCTA
GCCGAGGTTTGTCTCGACACTGCCATTGTCCCCGGCTGTTCAATGCTGACTCTGTCTGGTTCTGCCGCATAGCGC
GCCTTGGCCAACCAGCCATGGAAGGAATATACGGCCGAAGGAGGAAGGAAGTATTGGTACAATACCGAGACTAAG
CAGAGCTCTTGGGAGATGCCAGACATCTTCAAAAACGCTCTCACTGCCAGTGACGGCCGCAGTGCCGTTGGGCCC
CCAGCTGCCTACGCCCAACCACACCAACACCAACAGTCTCAGAGCTATGGCGCGCCAAATCGCTATGGGCCGCGC
GATCAAGGCCGCGGTGGTCGCGATGCCTTGTCAGATGGCAGACAGCTCTCGCGATCTTTTGTCCCAGCCTCGGAC
ATTGGCGCCGAGTATTCGTCCAAGGAAGAGGCCGTGGGAGCCTTCACCAAGGCATTGCGTCGGTTCGGCGTCCAG
CCCGACTGGGCTTGGGAAAAGGTGATGAAGACGGTTGGCAAAGACGCTCACTTCCAGGCAATCAAGCATCCCAAG
CTCCGCCGCGACACATTTGCCAAGTACTGCGAGGACCTGCTGCGCCAGGAAGAGGAGAGAGCCAAGGAAAGGCTA
TCCAAGCTACGCGCCGACTTTGAAATCATGCTCAAGAGGCACCCAGAAATCACGCACTTTACCCGGTGGAAGACA
GCCCGGCCCATGATTGAGGGCGAAACCATATTCCGCTCCACAGACAATGAGCAAGAGCGCCGATTGCTATTTGAC
GAGTACATTGCTAGCCTCAGGCAAGCCTACCAAGACAAGGTCAAGGCTCAACGCAACACGGCTTTGCAGGCACTC
AAGGACATGTTGCCCAAGCTCGACATCACTGCATATACGCGGTGGGCCGATGGACGAAACACCATCAAGGCCGCC
ATTGACGACGACGGCAAGTTTACAGTGCTAACAATGTCTGAGATTCTCGGTGCCTTTCAGGAACACGCCAAAGCT
CTCGAGAGAAGCCTCAACGAAAAGAGACAGCACGATAAAAAGATGAAGTATCGTAAAGAGCGTTGCAATCGCGAT
GCCTTCAAGTCCTTACTCGGCCAGCTGCGTAGAGACGGCCACATCAAGGCAGGGACCAAATGGTCCGACTTGTAC
CCCCTGCTTGAAAACGACGAGCGCTATCTCGACATGCTAGGCCAAGACGGCTCCAGCCCTCTCTCGCTATTCCGC
GATCTAGTCGAGGAAGAGGAACGGGCATTGCGTGGTCCTCGCAACGATGTCCTCGACGTACTAGAAGTGAGTCTT
GGCCACGCTTCGAGGAAGCAGGACAAGGAGCTGACGCGGTGCCAACAGGATAAGCGCTTCGTACTGACACCGTCG
ACCGCCTTCGATGATTTTGTAGCACTTCTCAAGGACGACCGTCGCACCGAAAGCATTGACGCCTCGGTTCTGCAA
CTCATTTTTGACAGAGTAGGGGCGCCTTTACTCATACTTCTTTGGGCCGCGACGTGTCGCTAATAGACTTTTTTC
AAAGCTTCGAGAGAAGCGAGCAGCTAAACACCAAGATGAAAAGCACAACAGCGAACGGAACCATCGTCACGCAAT
GGACAATGTGCGTCTATGTATGAAGAGGCTTGAGCCTCCAATATCCTTGGGCGACTCATACGAGAGTGTGCGGTC
ACGTCTATCCCAGACAGCAGAGCTCGAGACGGTTGGCTCGGAAGATGCTGTTCGACATGCCTTTGACCGCCACAT
GCGTCGGCTCAGGGACAAGGCGGATGAGGGCTCTGATCGTCGCCACCACCGCCGCAACAGCCACACCAGCCGCAC
CAGCCGCTTGTCGAGCGAGAGAGAGATGCCACGCCGTGCTCGTGAGCGTGAGCGTGATCGGTCGCGTGGAGAGCG
CTCTCATCGGGGGGGACGGCCCTCGCGCCGCAGCCGCAGCCCCGAGCCTGATCCTTACGAGGCTGATAGGCGAAG
GGCTGTGGCGGAGCGGGAGCGCAATCATCGCAAGTCAGCCATGGCTGAGAATGTACTGTCTGGTGAGCGCGCGCG
ACTGAGCCCTCCGCCGCGACGGGAGCGGGAGCGAGACCGTGACCGTGACCGGGATCGGGATCGGGATCGGGATCG
TGACCGCGACCGCGACCGTGACCGCGACCGGGACCGTGATCGCGACCGCGATAGGGATAGAGAACGAGACTATGA
TCGCTACGCCCGTTCCCGCCGCAGCGATGACTCGTCTTTTGCGCGTGATCGTCGCGAGCGCGAAAACGGCTTGGC
CGATCGGCCCCTGCGCCGCCCCATTGATAACCGCTCTGTCGATGAGCTCAACTATGGCGACGAGCGGCCCTCATC
TGCCCTTGGCTCTCGCCGCCGCCGCCCAAGCGACAGCGATGGCCTCCAGCGTGCCAAGGACTCACGCGATGCCAA
AGTAAGACCTCCTCTTGGCCGTCTCTTGTTATCTTGAAGACATCTCTATCCCTGCTATGCGTCGTGTTTGTTCAG
GCTTACAGTAATGGTAGCGCGTCAAATTGGATCCAGCATTGGATTCGAGTCCATCACAGCGCTCAGCCAGAGGAC
GAAACAAGTCTCCTCCTGCCGCCGCCGCCGTCTCTGCTATTAAGGAAGCCAGAGACATTCGCAGCGGTAGTGAGG
AAGGCGAAATAGAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail