Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2647
Gene name
LocationContig_187:2643..3769
Strand+
Gene length (bp)1126
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10444 Nbl1_Borealin_N Nbl1 / Borealin N terminal 3.0E-21 22 78

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2647
MVALKDSPRLRKKQTRVITASQKQALIDNLQLEVTERARRLRAQYSIQAQNLRSRVEIRVNRIPLSLRRMKMGDL
LAKYQRQQQQPRGHASRPLQAAAKDGSHLSPQKSTARHASRLVSGPSDGRSGDKENESGKVDNKRKARGAADTRH
VVPAQVLSPTSSNSRIVGRQGPISPFKSQIARPGSPLKTQATHRSAAVVLSSMVEKAKATRNGGMRKLTAASDEV
SSTTGAATKNRRPLTATGSRAPVSRPATRAAKRASGTSEASQGSTATVMNKADATRPVPPTKKTTMGVIRRGVVG
AGVKKTAAKSSTAATSSKTGGRVLRKRG*
Coding >OphauB2|2647
ATGGTGGCTCTCAAGGACAGTCCACGGCTCCGGAAGAAGCAGACAAGAGTCATTACCGCGTCTCAGAAGCAGGCC
CTCATTGACAATCTACAACTCGAAGTCACGGAACGCGCTCGCCGACTGCGTGCACAGTACAGCATCCAAGCTCAA
AATCTGAGATCGCGGGTGGAGATTCGCGTCAATAGAATTCCCCTATCCTTGCGCAGAATGAAGATGGGCGATCTC
TTGGCCAAGTATCAGCGGCAGCAACAGCAGCCTCGAGGGCATGCAAGTCGTCCACTACAAGCAGCTGCTAAAGAC
GGCTCGCACCTCAGTCCCCAAAAATCGACAGCGCGTCACGCCAGTCGTCTTGTCTCTGGCCCCAGCGATGGGCGT
TCTGGCGACAAGGAAAACGAAAGCGGCAAAGTGGACAACAAGAGGAAAGCACGCGGAGCAGCTGACACTCGTCAT
GTCGTGCCAGCTCAGGTGCTTTCGCCAACCTCGTCCAACTCGCGCATCGTAGGCCGTCAAGGTCCAATATCGCCA
TTCAAGTCGCAAATTGCCCGCCCTGGCTCTCCTTTGAAGACACAGGCGACGCATCGCTCTGCCGCCGTGGTCTTG
TCCAGCATGGTGGAAAAGGCAAAGGCGACACGCAACGGGGGCATGCGAAAGCTCACGGCAGCCTCGGATGAAGTG
TCGAGCACCACAGGCGCTGCTACCAAGAACCGACGGCCTCTTACGGCGACGGGATCCAGGGCTCCTGTGTCGAGA
CCGGCGACTCGTGCAGCCAAGCGTGCTAGTGGCACGAGTGAAGCCAGCCAGGGCAGCACGGCCACAGTGATGAAC
AAGGCTGACGCGACAAGGCCTGTGCCGCCGACAAAGAAGACCACCATGGGTGTCATTCGGAGAGGCGTTGTTGGA
GCGGGTGTCAAGAAGACGGCTGCCAAGTCGAGCACAGCCGCAACCTCATCCAAGACAGGCGGCCGCGTCTTGCGC
AAGCGAGGCTAA
Transcript >OphauB2|2647
ATGGTGGCTCTCAAGGACAGTCCACGGCTCCGGAAGAAGCAGACAAGAGTCATTACCGCGTCTCAGAAGCAGGCC
CTCATTGACAATCTACAACTCGAAGTCACGGAACGCGCTCGCCGACTGCGTGCACAGTACAGCATCCAAGCTCAA
AATCTGAGATCGCGGGTGGAGATTCGCGTCAATAGAATTCCCCTATCCTTGCGCAGAATGAAGATGGGCGATCTC
TTGGCCAAGTATCAGCGGCAGCAACAGCAGCCTCGAGGGCATGCAAGTCGTCCACTACAAGCAGCTGCTAAAGAC
GGCTCGCACCTCAGTCCCCAAAAATCGACAGCGCGTCACGCCAGTCGTCTTGTCTCTGGCCCCAGCGATGGGCGT
TCTGGCGACAAGGAAAACGAAAGCGGCAAAGTGGACAACAAGAGGAAAGCACGCGGAGCAGCTGACACTCGTCAT
GTCGTGCCAGCTCAGGTGCTTTCGCCAACCTCGTCCAACTCGCGCATCGTAGGCCGTCAAGGTCCAATATCGCCA
TTCAAGTCGCAAATTGCCCGCCCTGGCTCTCCTTTGAAGACACAGGCGACGCATCGCTCTGCCGCCGTGGTCTTG
TCCAGCATGGTGGAAAAGGCAAAGGCGACACGCAACGGGGGCATGCGAAAGCTCACGGCAGCCTCGGATGAAGTG
TCGAGCACCACAGGCGCTGCTACCAAGAACCGACGGCCTCTTACGGCGACGGGATCCAGGGCTCCTGTGTCGAGA
CCGGCGACTCGTGCAGCCAAGCGTGCTAGTGGCACGAGTGAAGCCAGCCAGGGCAGCACGGCCACAGTGATGAAC
AAGGCTGACGCGACAAGGCCTGTGCCGCCGACAAAGAAGACCACCATGGGTGTCATTCGGAGAGGCGTTGTTGGA
GCGGGTGTCAAGAAGACGGCTGCCAAGTCGAGCACAGCCGCAACCTCATCCAAGACAGGCGGCCGCGTCTTGCGC
AAGCGAGGCTAA
Gene >OphauB2|2647
ATGGTGGCTCTCAAGGACAGTCCACGGCTCCGGAAGAAGCAGACAAGAGTCATTACCGCGTCTCAGAAGCAGGCC
CTCATTGACAATCTACAACTCGAAGGTTGGCACACAATGGCGTCTCGCTTCTTTTGAGACTGTTGGGCTCACACG
CTGTCTAGTCACGGAACGCGCTCGCCGACTGCGTGCACAGTACAGCATCCAAGCTCAAAATCTGAGATCGCGGGT
GGAGATTCGCGTCAATAGAATTCCCCTATCCTTGCGCAGAATGAAGATGGGCGATCTCTTGGCCAAGTATCAGCG
GCAGCAACAGCAGCCTCGAGGGCATGCAAGTCGTCCACTACAAGCAGCTGCTAAAGACGGCTCGCACCTCAGTCC
CCAAAAATCGACAGCGCGTCACGCCAGTCGTCTTGTCTCTGGCCCCAGGTGAGTCTTGCTTGACGAGCCTTGACG
AGCCTTGACAAGCCTTGACAAGCCCTGACGAGCAATTGCTGACCCTCATGCTAGCGATGGGCGTTCTGGCGACAA
GGAAAACGAAAGCGGCAAAGTGGACAACAAGAGGAAAGCACGCGGAGCAGCTGACACTCGTCATGTCGTGCCAGC
TCAGGTGCTTTCGCCAACCTCGTCCAACTCGCGCATCGTAGGCCGTCAAGGTCCAATATCGCCATTCAAGTCGCA
AATTGCCCGCCCTGGCTCTCCTTTGAAGACACAGGCGACGCATCGCTCTGCCGCCGTGGTCTTGTCCAGCATGGT
GGAAAAGGCAAAGGCGACACGCAACGGGGGCATGCGAAAGCTCACGGCAGCCTCGGATGAAGTGTCGAGCACCAC
AGGCGCTGCTACCAAGAACCGACGGCCTCTTACGGCGACGGGATCCAGGGCTCCTGTGTCGAGACCGGCGACTCG
TGCAGCCAAGCGTGCTAGTGGCACGAGTGAAGCCAGCCAGGGCAGCACGGCCACAGTGATGAACAAGGCTGACGC
GACAAGGCCTGTGCCGCCGACAAAGAAGACCACCATGGGTGTCATTCGGAGAGGCGTTGTTGGAGCGGGTGTCAA
GAAGACGGCTGCCAAGTCGAGCACAGCCGCAACCTCATCCAAGACAGGCGGCCGCGTCTTGCGCAAGCGAGGCTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail