Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2646
Gene name
LocationContig_187:992..1918
Strand-
Gene length (bp)926
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13519 VWA_2 von Willebrand factor type A domain 2.1E-26 6 116
PF00092 VWA von Willebrand factor type A domain 3.8E-10 6 155
PF04056 Ssl1 Ssl1-like 7.0E-08 9 138

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55034|PSMD4_ARATH 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana GN=RPN10 PE=1 SV=1 1 241 3.0E-76
sp|O94444|RPN10_SCHPO 26S proteasome regulatory subunit rpn10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn10 PE=1 SV=1 1 253 1.0E-69
sp|P38886|RPN10_YEAST 26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN10 PE=1 SV=3 1 234 3.0E-64
sp|O35226|PSMD4_MOUSE 26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus GN=Psmd4 PE=1 SV=1 1 234 1.0E-59
sp|P55036|PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens GN=PSMD4 PE=1 SV=1 1 234 1.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55034|PSMD4_ARATH 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana GN=RPN10 PE=1 SV=1 1 241 3.0E-76
sp|O94444|RPN10_SCHPO 26S proteasome regulatory subunit rpn10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn10 PE=1 SV=1 1 253 1.0E-69
sp|P38886|RPN10_YEAST 26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN10 PE=1 SV=3 1 234 3.0E-64
sp|O35226|PSMD4_MOUSE 26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus GN=Psmd4 PE=1 SV=1 1 234 1.0E-59
sp|P55036|PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens GN=PSMD4 PE=1 SV=1 1 234 1.0E-59
sp|Q58DA0|PSMD4_BOVIN 26S proteasome non-ATPase regulatory subunit 4 OS=Bos taurus GN=PSMD4 PE=2 SV=1 1 234 1.0E-59
sp|Q553E0|PSMD4_DICDI 26S proteasome non-ATPase regulatory subunit 4 OS=Dictyostelium discoideum GN=psmD4 PE=2 SV=1 1 234 4.0E-56
sp|P55035|PSMD4_DROME 26S proteasome non-ATPase regulatory subunit 4 OS=Drosophila melanogaster GN=Rpn10 PE=1 SV=2 1 246 3.0E-54
sp|O17453|PSMD4_SCHMA 26S proteasome non-ATPase regulatory subunit 4 OS=Schistosoma mansoni PE=2 SV=2 1 242 6.0E-54
sp|A2A3N6|PIPSL_HUMAN Putative PIP5K1A and PSMD4-like protein OS=Homo sapiens GN=PIPSL PE=5 SV=1 3 234 3.0E-47
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2646
MVLEAVMVVVDNSESSRNGDYQPTRFDSQVDAVTVLFQSITQGNPESSVGLMSMGGKGPEVLVTLTTEQGKILDG
LHRTKKKIGGSSHLKRGIQIAALALKHRQNRSQRQRIIVFVCSPIEEDEKELTLLAKKMKKGNTLVDFVLFGDLD
DDKTQKKLEAFNTAVKGNEGSHLVVIPPSSKLLSDQLISTPVMLGENVSGQGASSTAPGGGDEFEFGFDPALEPE
LALALRMSMEEEKARQEKRAREEEEEAKKASLSDVKEDDESGGAGGSGSGGQSDKKEDGDKMDTS*
Coding >OphauB2|2646
ATGGTCCTCGAGGCCGTCATGGTTGTCGTGGACAATAGCGAGAGCAGCAGAAATGGCGACTACCAACCCACCCGG
TTCGACTCCCAAGTCGATGCCGTGACAGTCCTCTTCCAGAGCATTACCCAAGGCAACCCCGAGTCGTCAGTTGGC
CTGATGAGCATGGGCGGCAAGGGACCCGAGGTGCTCGTCACCCTGACGACGGAGCAGGGAAAGATCCTCGACGGG
TTGCACCGAACCAAGAAGAAGATTGGCGGCTCGTCGCACCTAAAAAGGGGCATCCAAATTGCGGCGCTTGCTCTC
AAACACCGACAGAATCGTTCCCAACGACAGCGAATAATAGTCTTTGTGTGCTCGCCGATTGAAGAAGACGAAAAG
GAGCTGACGCTCCTGGCCAAGAAGATGAAAAAGGGCAATACTCTGGTAGACTTTGTGCTTTTTGGAGATCTGGAC
GACGACAAGACCCAAAAAAAGCTCGAGGCCTTCAACACAGCCGTCAAGGGCAACGAGGGCTCTCACCTTGTCGTG
ATTCCACCAAGCAGCAAACTCCTCAGCGACCAGCTCATATCCACCCCAGTCATGCTGGGCGAAAATGTCTCGGGG
CAAGGGGCTTCCAGCACTGCTCCGGGTGGTGGCGACGAGTTTGAATTTGGCTTTGACCCTGCCCTGGAGCCCGAG
CTTGCACTGGCTCTGCGCATGAGTATGGAGGAGGAAAAGGCGCGACAGGAAAAGCGGGCGCGCGAAGAGGAGGAA
GAGGCCAAGAAGGCATCCCTCTCCGACGTCAAGGAGGACGACGAGTCTGGTGGGGCGGGCGGCAGCGGCAGCGGA
GGGCAAAGTGACAAGAAGGAGGATGGAGACAAGATGGATACATCGTAA
Transcript >OphauB2|2646
ATGGTCCTCGAGGCCGTCATGGTTGTCGTGGACAATAGCGAGAGCAGCAGAAATGGCGACTACCAACCCACCCGG
TTCGACTCCCAAGTCGATGCCGTGACAGTCCTCTTCCAGAGCATTACCCAAGGCAACCCCGAGTCGTCAGTTGGC
CTGATGAGCATGGGCGGCAAGGGACCCGAGGTGCTCGTCACCCTGACGACGGAGCAGGGAAAGATCCTCGACGGG
TTGCACCGAACCAAGAAGAAGATTGGCGGCTCGTCGCACCTAAAAAGGGGCATCCAAATTGCGGCGCTTGCTCTC
AAACACCGACAGAATCGTTCCCAACGACAGCGAATAATAGTCTTTGTGTGCTCGCCGATTGAAGAAGACGAAAAG
GAGCTGACGCTCCTGGCCAAGAAGATGAAAAAGGGCAATACTCTGGTAGACTTTGTGCTTTTTGGAGATCTGGAC
GACGACAAGACCCAAAAAAAGCTCGAGGCCTTCAACACAGCCGTCAAGGGCAACGAGGGCTCTCACCTTGTCGTG
ATTCCACCAAGCAGCAAACTCCTCAGCGACCAGCTCATATCCACCCCAGTCATGCTGGGCGAAAATGTCTCGGGG
CAAGGGGCTTCCAGCACTGCTCCGGGTGGTGGCGACGAGTTTGAATTTGGCTTTGACCCTGCCCTGGAGCCCGAG
CTTGCACTGGCTCTGCGCATGAGTATGGAGGAGGAAAAGGCGCGACAGGAAAAGCGGGCGCGCGAAGAGGAGGAA
GAGGCCAAGAAGGCATCCCTCTCCGACGTCAAGGAGGACGACGAGTCTGGTGGGGCGGGCGGCAGCGGCAGCGGA
GGGCAAAGTGACAAGAAGGAGGATGGAGACAAGATGGATACATCGTAA
Gene >OphauB2|2646
ATGGTCCTCGAGGCCGTCATGGTTGTCGTGGACAATAGCGAGAGCAGCAGAAATGGCGACTACCAACCCACCCGG
TTCGACTCCCAAGTCGATGCCGTGACAGTCCTCTTCCAGAGCATTACCCAAGGCAACCCCGAGTCGTCAGTTGGC
CTGATGAGCATGGGCGGCAAGGGACCCGAGGTGCTCGTCACCCTGACGACGGAGCAGGGAAAGATCCTCGACGGG
TTGCACCGAACCAAGAAGAAGATTGGCGGCTCGTCGCACCTAAAAAGGGGCATCCAAATTGCGGCGGTGAGGACT
AGTGCACTCTTGTCGTGGCCACGTCTTGGCTAACTCAATGGCAGCTTGCTCTCAAACACCGACAGAATCGTTCCC
AACGACAGCGAATAATAGTCTTTGTGTGCTCGCCGATTGAAGAAGACGAAAAGGAGCTGACGCTCCTGGCCAAGA
AGATGAAAAAGGGCAATACTCTGGTAGACTTTGTGCTTTTTGGAGATCTGGACGACGACAAGACCCAAAAAAAGC
TCGAGGCCTTCAACACAGCCGTCAAGGGCAACGAGGGCTCTCACCTTGTCGTGATTCCACCAAGCAGCAAACTCC
TCAGCGACCAGCTCATATCCACCCCAGTCATGCTGGGCGAAAATGTCTCGGGGCAAGGGGCTTCCAGCACTGCTC
CGGGTGGTGGCGACGAGTTTGAATTTGGCTTTGACCCTGCCCTGGAGCCCGAGCTTGCACTGGCTCTGCGCATGA
GTATGGAGGAGGAAAAGGCGCGACAGGAAAAGCGGGCGCGCGAAGAGGAGGAAGAGGCCAAGAAGGCATCCCTCT
CCGACGTCAAGGAGGACGACGAGTCTGGTGGGGCGGGCGGCAGCGGCAGCGGAGGGCAAAGTGACAAGAAGGAGG
ATGGAGACAAGATGGATACATCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail