Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2646
Gene name
LocationContig_187:992..1918
Strand-
Gene length (bp)926
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13519 VWA_2 von Willebrand factor type A domain 2.1E-26 6 116
PF00092 VWA von Willebrand factor type A domain 3.8E-10 6 155
PF04056 Ssl1 Ssl1-like 7.0E-08 9 138

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55034|PSMD4_ARATH 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana GN=RPN10 PE=1 SV=1 1 241 3.0E-76
sp|O94444|RPN10_SCHPO 26S proteasome regulatory subunit rpn10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn10 PE=1 SV=1 1 253 1.0E-69
sp|P38886|RPN10_YEAST 26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN10 PE=1 SV=3 1 234 3.0E-64
sp|O35226|PSMD4_MOUSE 26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus GN=Psmd4 PE=1 SV=1 1 234 1.0E-59
sp|P55036|PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens GN=PSMD4 PE=1 SV=1 1 234 1.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55034|PSMD4_ARATH 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana GN=RPN10 PE=1 SV=1 1 241 3.0E-76
sp|O94444|RPN10_SCHPO 26S proteasome regulatory subunit rpn10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn10 PE=1 SV=1 1 253 1.0E-69
sp|P38886|RPN10_YEAST 26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN10 PE=1 SV=3 1 234 3.0E-64
sp|O35226|PSMD4_MOUSE 26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus GN=Psmd4 PE=1 SV=1 1 234 1.0E-59
sp|P55036|PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens GN=PSMD4 PE=1 SV=1 1 234 1.0E-59
sp|Q58DA0|PSMD4_BOVIN 26S proteasome non-ATPase regulatory subunit 4 OS=Bos taurus GN=PSMD4 PE=2 SV=1 1 234 1.0E-59
sp|Q553E0|PSMD4_DICDI 26S proteasome non-ATPase regulatory subunit 4 OS=Dictyostelium discoideum GN=psmD4 PE=2 SV=1 1 234 4.0E-56
sp|P55035|PSMD4_DROME 26S proteasome non-ATPase regulatory subunit 4 OS=Drosophila melanogaster GN=Rpn10 PE=1 SV=2 1 246 3.0E-54
sp|O17453|PSMD4_SCHMA 26S proteasome non-ATPase regulatory subunit 4 OS=Schistosoma mansoni PE=2 SV=2 1 242 6.0E-54
sp|A2A3N6|PIPSL_HUMAN Putative PIP5K1A and PSMD4-like protein OS=Homo sapiens GN=PIPSL PE=5 SV=1 3 234 3.0E-47
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1927
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6118
Ophiocordyceps australis map64 (Brazil) OphauB2|2646 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07321
Ophiocordyceps camponoti-rufipedis Ophun1|4437
Ophiocordyceps kimflemingae Ophio5|8364
Ophiocordyceps subramaniannii Hirsu2|2057

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2646
MVLEAVMVVVDNSESSRNGDYQPTRFDSQVDAVTVLFQSITQGNPESSVGLMSMGGKGPEVLVTLTTEQGKILDG
LHRTKKKIGGSSHLKRGIQIAALALKHRQNRSQRQRIIVFVCSPIEEDEKELTLLAKKMKKGNTLVDFVLFGDLD
DDKTQKKLEAFNTAVKGNEGSHLVVIPPSSKLLSDQLISTPVMLGENVSGQGASSTAPGGGDEFEFGFDPALEPE
LALALRMSMEEEKARQEKRAREEEEEAKKASLSDVKEDDESGGAGGSGSGGQSDKKEDGDKMDTS*
Coding >OphauB2|2646
ATGGTCCTCGAGGCCGTCATGGTTGTCGTGGACAATAGCGAGAGCAGCAGAAATGGCGACTACCAACCCACCCGG
TTCGACTCCCAAGTCGATGCCGTGACAGTCCTCTTCCAGAGCATTACCCAAGGCAACCCCGAGTCGTCAGTTGGC
CTGATGAGCATGGGCGGCAAGGGACCCGAGGTGCTCGTCACCCTGACGACGGAGCAGGGAAAGATCCTCGACGGG
TTGCACCGAACCAAGAAGAAGATTGGCGGCTCGTCGCACCTAAAAAGGGGCATCCAAATTGCGGCGCTTGCTCTC
AAACACCGACAGAATCGTTCCCAACGACAGCGAATAATAGTCTTTGTGTGCTCGCCGATTGAAGAAGACGAAAAG
GAGCTGACGCTCCTGGCCAAGAAGATGAAAAAGGGCAATACTCTGGTAGACTTTGTGCTTTTTGGAGATCTGGAC
GACGACAAGACCCAAAAAAAGCTCGAGGCCTTCAACACAGCCGTCAAGGGCAACGAGGGCTCTCACCTTGTCGTG
ATTCCACCAAGCAGCAAACTCCTCAGCGACCAGCTCATATCCACCCCAGTCATGCTGGGCGAAAATGTCTCGGGG
CAAGGGGCTTCCAGCACTGCTCCGGGTGGTGGCGACGAGTTTGAATTTGGCTTTGACCCTGCCCTGGAGCCCGAG
CTTGCACTGGCTCTGCGCATGAGTATGGAGGAGGAAAAGGCGCGACAGGAAAAGCGGGCGCGCGAAGAGGAGGAA
GAGGCCAAGAAGGCATCCCTCTCCGACGTCAAGGAGGACGACGAGTCTGGTGGGGCGGGCGGCAGCGGCAGCGGA
GGGCAAAGTGACAAGAAGGAGGATGGAGACAAGATGGATACATCGTAA
Transcript >OphauB2|2646
ATGGTCCTCGAGGCCGTCATGGTTGTCGTGGACAATAGCGAGAGCAGCAGAAATGGCGACTACCAACCCACCCGG
TTCGACTCCCAAGTCGATGCCGTGACAGTCCTCTTCCAGAGCATTACCCAAGGCAACCCCGAGTCGTCAGTTGGC
CTGATGAGCATGGGCGGCAAGGGACCCGAGGTGCTCGTCACCCTGACGACGGAGCAGGGAAAGATCCTCGACGGG
TTGCACCGAACCAAGAAGAAGATTGGCGGCTCGTCGCACCTAAAAAGGGGCATCCAAATTGCGGCGCTTGCTCTC
AAACACCGACAGAATCGTTCCCAACGACAGCGAATAATAGTCTTTGTGTGCTCGCCGATTGAAGAAGACGAAAAG
GAGCTGACGCTCCTGGCCAAGAAGATGAAAAAGGGCAATACTCTGGTAGACTTTGTGCTTTTTGGAGATCTGGAC
GACGACAAGACCCAAAAAAAGCTCGAGGCCTTCAACACAGCCGTCAAGGGCAACGAGGGCTCTCACCTTGTCGTG
ATTCCACCAAGCAGCAAACTCCTCAGCGACCAGCTCATATCCACCCCAGTCATGCTGGGCGAAAATGTCTCGGGG
CAAGGGGCTTCCAGCACTGCTCCGGGTGGTGGCGACGAGTTTGAATTTGGCTTTGACCCTGCCCTGGAGCCCGAG
CTTGCACTGGCTCTGCGCATGAGTATGGAGGAGGAAAAGGCGCGACAGGAAAAGCGGGCGCGCGAAGAGGAGGAA
GAGGCCAAGAAGGCATCCCTCTCCGACGTCAAGGAGGACGACGAGTCTGGTGGGGCGGGCGGCAGCGGCAGCGGA
GGGCAAAGTGACAAGAAGGAGGATGGAGACAAGATGGATACATCGTAA
Gene >OphauB2|2646
ATGGTCCTCGAGGCCGTCATGGTTGTCGTGGACAATAGCGAGAGCAGCAGAAATGGCGACTACCAACCCACCCGG
TTCGACTCCCAAGTCGATGCCGTGACAGTCCTCTTCCAGAGCATTACCCAAGGCAACCCCGAGTCGTCAGTTGGC
CTGATGAGCATGGGCGGCAAGGGACCCGAGGTGCTCGTCACCCTGACGACGGAGCAGGGAAAGATCCTCGACGGG
TTGCACCGAACCAAGAAGAAGATTGGCGGCTCGTCGCACCTAAAAAGGGGCATCCAAATTGCGGCGGTGAGGACT
AGTGCACTCTTGTCGTGGCCACGTCTTGGCTAACTCAATGGCAGCTTGCTCTCAAACACCGACAGAATCGTTCCC
AACGACAGCGAATAATAGTCTTTGTGTGCTCGCCGATTGAAGAAGACGAAAAGGAGCTGACGCTCCTGGCCAAGA
AGATGAAAAAGGGCAATACTCTGGTAGACTTTGTGCTTTTTGGAGATCTGGACGACGACAAGACCCAAAAAAAGC
TCGAGGCCTTCAACACAGCCGTCAAGGGCAACGAGGGCTCTCACCTTGTCGTGATTCCACCAAGCAGCAAACTCC
TCAGCGACCAGCTCATATCCACCCCAGTCATGCTGGGCGAAAATGTCTCGGGGCAAGGGGCTTCCAGCACTGCTC
CGGGTGGTGGCGACGAGTTTGAATTTGGCTTTGACCCTGCCCTGGAGCCCGAGCTTGCACTGGCTCTGCGCATGA
GTATGGAGGAGGAAAAGGCGCGACAGGAAAAGCGGGCGCGCGAAGAGGAGGAAGAGGCCAAGAAGGCATCCCTCT
CCGACGTCAAGGAGGACGACGAGTCTGGTGGGGCGGGCGGCAGCGGCAGCGGAGGGCAAAGTGACAAGAAGGAGG
ATGGAGACAAGATGGATACATCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail