Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2638
Gene name
LocationContig_186:24871..25529
Strand-
Gene length (bp)658
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family 4.1E-32 13 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P59670|TIM17_NEUCR Mitochondrial import inner membrane translocase subunit tim17 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim17 PE=2 SV=1 1 148 4.0E-88
sp|P87130|TIM17_SCHPO Mitochondrial import inner membrane translocase subunit tim17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim17 PE=3 SV=1 2 133 5.0E-71
sp|P39515|TIM17_YEAST Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM17 PE=1 SV=1 2 143 7.0E-70
sp|Q9SP35|TI172_ARATH Mitochondrial import inner membrane translocase subunit TIM17-2 OS=Arabidopsis thaliana GN=TIM17-2 PE=1 SV=2 2 142 4.0E-42
sp|Q99595|TI17A_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-A OS=Homo sapiens GN=TIMM17A PE=1 SV=1 2 148 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P59670|TIM17_NEUCR Mitochondrial import inner membrane translocase subunit tim17 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim17 PE=2 SV=1 1 148 4.0E-88
sp|P87130|TIM17_SCHPO Mitochondrial import inner membrane translocase subunit tim17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim17 PE=3 SV=1 2 133 5.0E-71
sp|P39515|TIM17_YEAST Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM17 PE=1 SV=1 2 143 7.0E-70
sp|Q9SP35|TI172_ARATH Mitochondrial import inner membrane translocase subunit TIM17-2 OS=Arabidopsis thaliana GN=TIM17-2 PE=1 SV=2 2 142 4.0E-42
sp|Q99595|TI17A_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-A OS=Homo sapiens GN=TIMM17A PE=1 SV=1 2 148 2.0E-40
sp|Q9LN27|TI171_ARATH Mitochondrial import inner membrane translocase subunit TIM17-1 OS=Arabidopsis thaliana GN=TIM17-1 PE=2 SV=1 2 135 2.0E-40
sp|Q9Z0V8|TI17A_MOUSE Mitochondrial import inner membrane translocase subunit Tim17-A OS=Mus musculus GN=Timm17a PE=1 SV=1 2 137 3.0E-40
sp|O35092|TI17A_RAT Mitochondrial import inner membrane translocase subunit Tim17-A OS=Rattus norvegicus GN=Timm17a PE=2 SV=1 2 137 9.0E-40
sp|O60830|TI17B_HUMAN Mitochondrial import inner membrane translocase subunit Tim17-B OS=Homo sapiens GN=TIMM17B PE=1 SV=1 2 147 3.0E-39
sp|Q9Z0V7|TI17B_MOUSE Mitochondrial import inner membrane translocase subunit Tim17-B OS=Mus musculus GN=Timm17b PE=1 SV=1 2 143 1.0E-38
sp|Q2HJE9|TI17B_BOVIN Mitochondrial import inner membrane translocase subunit Tim17-B OS=Bos taurus GN=TIMM17B PE=2 SV=1 2 148 1.0E-38
sp|Q9VNA0|TI17A_DROME Probable mitochondrial import inner membrane translocase subunit Tim17 1 OS=Drosophila melanogaster GN=Tim17b1 PE=2 SV=2 2 143 5.0E-37
sp|Q9VGA2|TI17C_DROME Probable mitochondrial import inner membrane translocase subunit Tim17 3 OS=Drosophila melanogaster GN=Tim17a1 PE=2 SV=1 1 127 2.0E-35
sp|Q9VN97|TI17D_DROME Probable mitochondrial import inner membrane translocase subunit Tim17 4 OS=Drosophila melanogaster GN=Tim17a2 PE=3 SV=1 1 137 1.0E-34
sp|O44477|TIM17_CAEEL Probable mitochondrial import inner membrane translocase subunit Tim17 OS=Caenorhabditis elegans GN=tim-17 PE=3 SV=1 2 128 9.0E-34
sp|Q9LYG1|TI173_ARATH Mitochondrial import inner membrane translocase subunit TIM17-3 OS=Arabidopsis thaliana GN=TIM17-3 PE=2 SV=1 10 124 4.0E-28
sp|Q54K35|TIM17_DICDI Mitochondrial import inner membrane translocase subunit tim17 OS=Dictyostelium discoideum GN=timm17 PE=3 SV=1 7 145 2.0E-21
sp|Q6BZY4|TIM22_YARLI Mitochondrial import inner membrane translocase subunit TIM22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM22 PE=3 SV=2 32 124 2.0E-09
sp|Q6BT35|TIM22_DEBHA Mitochondrial import inner membrane translocase subunit TIM22 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM22 PE=3 SV=1 31 124 1.0E-08
sp|P87146|TIM22_SCHPO Mitochondrial import inner membrane translocase subunit tim22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim22 PE=3 SV=1 62 108 2.0E-07
sp|Q6FT37|TIM22_CANGA Mitochondrial import inner membrane translocase subunit TIM22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM22 PE=3 SV=1 55 124 5.0E-07
sp|A1XJK0|TI224_ARATH Mitochondrial import inner membrane translocase subunit TIM22-4 OS=Arabidopsis thaliana GN=TIM22-4 PE=2 SV=3 62 124 6.0E-07
sp|A2RVP7|TI221_ARATH Mitochondrial import inner membrane translocase subunit TIM22-1 OS=Arabidopsis thaliana GN=TIM22-1 PE=1 SV=1 62 124 1.0E-06
sp|Q12328|TIM22_YEAST Mitochondrial import inner membrane translocase subunit TIM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM22 PE=1 SV=1 27 109 2.0E-06
sp|Q6CRJ6|TIM22_KLULA Mitochondrial import inner membrane translocase subunit TIM22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM22 PE=3 SV=1 29 124 4.0E-06
sp|Q9C1E8|TIM22_NEUCR Mitochondrial import inner membrane translocase subunit tim22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim22 PE=3 SV=2 32 124 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 112 134 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2638
MDHGRDPCPWVILNDFGGAFCMGAIGGTIWHGIKGFRNSPYGERRIGAITAVKMRAPVLGGNFGVWGGLFSTFDC
AVKGVRQKEDPYNAIIAGFFTGGSLAIRGGYRSARNGAIGCAVLLAVIEGVGIGFSKMLSGNTKLEMPQTVPA*
Coding >OphauB2|2638
ATGGACCACGGCCGAGATCCCTGCCCCTGGGTTATTCTCAATGACTTTGGAGGTGCATTTTGCATGGGGGCTATT
GGCGGCACCATCTGGCATGGCATCAAGGGCTTCCGTAACTCGCCCTACGGAGAGCGACGCATCGGCGCCATTACT
GCTGTCAAGATGCGCGCGCCCGTGCTGGGCGGCAACTTTGGCGTCTGGGGCGGCCTTTTTTCCACCTTTGACTGC
GCCGTCAAGGGCGTGCGGCAAAAGGAGGATCCGTACAATGCGATTATAGCCGGCTTCTTTACCGGCGGGTCGCTG
GCGATTCGCGGCGGGTACCGGTCAGCGCGCAATGGCGCCATCGGCTGTGCGGTCCTGCTGGCCGTCATTGAGGGC
GTGGGCATTGGCTTTTCCAAAATGCTGTCCGGGAATACAAAACTGGAGATGCCACAAACGGTGCCGGCATAG
Transcript >OphauB2|2638
ATGGACCACGGCCGAGATCCCTGCCCCTGGGTTATTCTCAATGACTTTGGAGGTGCATTTTGCATGGGGGCTATT
GGCGGCACCATCTGGCATGGCATCAAGGGCTTCCGTAACTCGCCCTACGGAGAGCGACGCATCGGCGCCATTACT
GCTGTCAAGATGCGCGCGCCCGTGCTGGGCGGCAACTTTGGCGTCTGGGGCGGCCTTTTTTCCACCTTTGACTGC
GCCGTCAAGGGCGTGCGGCAAAAGGAGGATCCGTACAATGCGATTATAGCCGGCTTCTTTACCGGCGGGTCGCTG
GCGATTCGCGGCGGGTACCGGTCAGCGCGCAATGGCGCCATCGGCTGTGCGGTCCTGCTGGCCGTCATTGAGGGC
GTGGGCATTGGCTTTTCCAAAATGCTGTCCGGGAATACAAAACTGGAGATGCCACAAACGGTGCCGGCATAG
Gene >OphauB2|2638
ATGGACCACGGCCGAGATCCCTGCCCCTGGGTTATTCTCAATGACTTTGGAGGTGCATTTTGCATGGGGGTGTGT
ATGATTTCTTTCTCTTTTATCCATTGTGCGGGCTGCAGGAGACGGCTCGTGCACTGAGGCACTGACGAGGGCAGA
AGGGGCAATAAGAAATACAACAGGGAAGCAGAATGAGATGGATCCAAGAAGCAAGAAGAGGACAAGACGAGAAGG
AGGAAACGAGAAAAAGACAAGTCCAAGGCTAACCATTTTCCTCGGCACTCAACAGGCTATTGGCGGCACCATCTG
GCATGGCATCAAGGGCTTCCGTAACTCGCCCTACGGAGAGCGACGCATCGGCGCCATTACTGCTGTCAAGATGCG
CGCGCCCGTGCTGGGCGGCAACTTTGGCGTCTGGGGCGGCCTTTTTTCCACCTTTGACTGCGCCGTCAAGGGCGT
GCGGCAAAAGGAGGATCCGTACAATGCGATTATAGCCGGCTTCTTTACCGGCGGGTCGCTGGCGATTCGCGGCGG
GTACCGGTCAGCGCGCAATGGCGCCATCGGCTGTGCGGTCCTGCTGGCCGTCATTGAGGGCGTGGGCATTGGCTT
TTCCAAAATGCTGTCCGGGAATACAAAACTGGAGATGCCACAAACGGTGCCGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail