Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2636
Gene name
LocationContig_186:15449..17680
Strand-
Gene length (bp)2231
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.1E-22 203 380
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 5.2E-18 74 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50118|MOS_PIG Proto-oncogene serine/threonine-protein kinase mos OS=Sus scrofa GN=MOS PE=2 SV=1 72 294 1.0E-12
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 75 294 3.0E-12
sp|P12965|MOS_XENLA Serine/threonine-protein kinase mos OS=Xenopus laevis GN=mos PE=2 SV=1 69 294 1.0E-11
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 72 294 2.0E-10
sp|P00539|MOS_RAT Proto-oncogene serine/threonine-protein kinase mos OS=Rattus norvegicus GN=Mos PE=2 SV=2 67 294 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50118|MOS_PIG Proto-oncogene serine/threonine-protein kinase mos OS=Sus scrofa GN=MOS PE=2 SV=1 72 294 1.0E-12
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 75 294 3.0E-12
sp|P12965|MOS_XENLA Serine/threonine-protein kinase mos OS=Xenopus laevis GN=mos PE=2 SV=1 69 294 1.0E-11
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 72 294 2.0E-10
sp|P00539|MOS_RAT Proto-oncogene serine/threonine-protein kinase mos OS=Rattus norvegicus GN=Mos PE=2 SV=2 67 294 7.0E-10
sp|Q95M30|HCK_MACFA Tyrosine-protein kinase HCK OS=Macaca fascicularis GN=HCK PE=2 SV=3 75 294 8.0E-10
sp|P10650|MOS_CHLAE Proto-oncogene serine/threonine-protein kinase mos OS=Chlorocebus aethiops GN=MOS PE=3 SV=1 72 294 1.0E-09
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 71 294 1.0E-09
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 75 290 1.0E-09
sp|P08631|HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5 75 294 2.0E-09
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 207 288 3.0E-09
sp|P00540|MOS_HUMAN Proto-oncogene serine/threonine-protein kinase mos OS=Homo sapiens GN=MOS PE=1 SV=1 72 308 4.0E-09
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 194 294 5.0E-09
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 194 294 5.0E-09
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 194 294 5.0E-09
sp|Q94C25|Y5005_ARATH Probable receptor-like protein kinase At5g20050 OS=Arabidopsis thaliana GN=At5g20050 PE=2 SV=1 207 292 5.0E-09
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 72 286 7.0E-09
sp|Q9CAL3|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=2 SV=1 67 308 8.0E-09
sp|O74526|KJ45_SCHPO Probable serine/threonine-protein kinase C70.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC70.05c PE=1 SV=1 92 342 9.0E-09
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 198 294 1.0E-08
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 201 340 1.0E-08
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 66 294 1.0E-08
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 201 340 1.0E-08
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 189 468 1.0E-08
sp|Q9GRC0|MOS_PATPE Serine/threonine-protein kinase mos OS=Patiria pectinifera GN=mos PE=1 SV=1 73 294 1.0E-08
sp|P10741|MOS_CHICK Serine/threonine-protein kinase mos OS=Gallus gallus GN=MOS PE=3 SV=1 55 293 2.0E-08
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 210 293 2.0E-08
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 196 288 2.0E-08
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 196 288 2.0E-08
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 196 288 2.0E-08
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 196 288 2.0E-08
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 201 314 2.0E-08
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 189 380 2.0E-08
sp|Q90XV6|MOS_GYMCA Serine/threonine-protein kinase mos (Fragment) OS=Gymnogyps californianus GN=MOS PE=3 SV=1 72 269 2.0E-08
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 75 292 2.0E-08
sp|P08103|HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus GN=Hck PE=1 SV=4 75 294 2.0E-08
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 69 294 2.0E-08
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 210 295 2.0E-08
sp|P87347|MOS_APTAU Serine/threonine-protein kinase mos (Fragment) OS=Apteryx australis GN=MOS PE=3 SV=1 72 269 2.0E-08
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 72 293 2.0E-08
sp|P50545|HCK_RAT Tyrosine-protein kinase HCK OS=Rattus norvegicus GN=Hck PE=1 SV=4 75 294 2.0E-08
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 69 294 2.0E-08
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 69 294 2.0E-08
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 75 293 3.0E-08
sp|Q90XV8|MOS_CICNG Serine/threonine-protein kinase mos (Fragment) OS=Ciconia nigra GN=MOS PE=3 SV=1 72 269 3.0E-08
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 72 317 3.0E-08
sp|Q90XV9|MOS_NYCNY Serine/threonine-protein kinase mos (Fragment) OS=Nycticorax nycticorax GN=MOS PE=3 SV=1 72 269 4.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 64 294 4.0E-08
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 196 294 4.0E-08
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 189 334 4.0E-08
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 170 294 4.0E-08
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 69 293 4.0E-08
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 69 293 4.0E-08
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 69 293 5.0E-08
sp|C0LGU1|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1 208 294 5.0E-08
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 189 294 5.0E-08
sp|P10421|MOS_MSVTS Serine/threonine-protein kinase-transforming protein mos OS=Myeloproliferative sarcoma virus (isolate ts159) GN=V-MOS PE=3 SV=1 75 294 5.0E-08
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 75 294 6.0E-08
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 75 294 6.0E-08
sp|Q7T6Y1|YR436_MIMIV Putative serine/threonine-protein kinase R436 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R436 PE=3 SV=2 183 287 6.0E-08
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 75 294 7.0E-08
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 71 290 7.0E-08
sp|Q9LK43|TMK4_ARATH Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1 75 332 7.0E-08
sp|P42683|LCK_CHICK Proto-oncogene tyrosine-protein kinase LCK OS=Gallus gallus GN=LCK PE=2 SV=2 68 294 7.0E-08
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 115 296 7.0E-08
sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 76 292 8.0E-08
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 71 307 9.0E-08
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 55 289 9.0E-08
sp|Q552C6|ZAK2_DICDI Dual specificity protein kinase zak2 OS=Dictyostelium discoideum GN=zak2 PE=1 SV=1 157 293 1.0E-07
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 72 286 1.0E-07
sp|Q6NU47|PDK1A_XENLA Serine/threonine-protein kinase pdik1l-A OS=Xenopus laevis GN=pdik1-a PE=2 SV=1 202 384 1.0E-07
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 207 296 1.0E-07
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 202 384 1.0E-07
sp|Q90XV7|MOS_VULGR Serine/threonine-protein kinase mos (Fragment) OS=Vultur gryphus GN=MOS PE=3 SV=1 72 269 2.0E-07
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 115 296 2.0E-07
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 170 294 2.0E-07
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 199 293 2.0E-07
sp|P00537|MOS_MSVMM Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain m1) GN=V-MOS PE=3 SV=1 75 294 2.0E-07
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 207 296 2.0E-07
sp|P00536|MOS_MOUSE Proto-oncogene serine/threonine-protein kinase mos OS=Mus musculus GN=Mos PE=2 SV=2 75 294 2.0E-07
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 198 296 2.0E-07
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 189 469 2.0E-07
sp|P07331|MOS_MSVMH Serine/threonine-protein kinase-transforming protein mos OS=Moloney murine sarcoma virus (strain HT-1) GN=V-MOS PE=2 SV=1 75 294 2.0E-07
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 210 293 2.0E-07
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 56 384 2.0E-07
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 115 296 2.0E-07
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 71 290 3.0E-07
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 115 296 3.0E-07
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 71 313 3.0E-07
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 75 288 3.0E-07
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 167 294 3.0E-07
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 71 290 3.0E-07
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 71 290 4.0E-07
sp|P25848|PHY1_CERPU Light-sensor Protein kinase OS=Ceratodon purpureus GN=PHY1 PE=3 SV=3 41 294 4.0E-07
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 72 286 4.0E-07
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 170 288 5.0E-07
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 207 294 5.0E-07
sp|Q07174|M3K8_MOUSE Mitogen-activated protein kinase kinase kinase 8 OS=Mus musculus GN=Map3k8 PE=1 SV=1 207 294 5.0E-07
sp|P54742|AFSK_STRGR Serine/threonine-protein kinase AfsK OS=Streptomyces griseus GN=afsK PE=3 SV=1 203 294 5.0E-07
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 197 294 5.0E-07
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 207 307 5.0E-07
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 189 577 5.0E-07
sp|Q63562|M3K8_RAT Mitogen-activated protein kinase kinase kinase 8 OS=Rattus norvegicus GN=Map3k8 PE=1 SV=1 207 294 5.0E-07
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 170 294 6.0E-07
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 170 294 6.0E-07
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 170 294 6.0E-07
sp|P41279|M3K8_HUMAN Mitogen-activated protein kinase kinase kinase 8 OS=Homo sapiens GN=MAP3K8 PE=1 SV=2 207 294 6.0E-07
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 207 307 7.0E-07
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 75 297 7.0E-07
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 192 294 7.0E-07
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 170 307 7.0E-07
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 71 290 7.0E-07
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 207 290 7.0E-07
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 75 294 8.0E-07
sp|Q1RMT8|IRAK4_BOVIN Interleukin-1 receptor-associated kinase 4 OS=Bos taurus GN=IRAK4 PE=2 SV=1 62 296 8.0E-07
sp|P54741|AFSK_STRCO Serine/threonine-protein kinase AfsK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsK PE=1 SV=2 203 294 8.0E-07
sp|Q9XI96|PERK7_ARATH Proline-rich receptor-like protein kinase PERK7 OS=Arabidopsis thaliana GN=PERK7 PE=2 SV=1 75 316 8.0E-07
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 207 380 9.0E-07
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 75 296 9.0E-07
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 207 292 1.0E-06
sp|Q9LSL5|LRK92_ARATH L-type lectin-domain containing receptor kinase IX.2 OS=Arabidopsis thaliana GN=LECRK92 PE=2 SV=1 207 294 1.0E-06
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 189 380 1.0E-06
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 198 378 1.0E-06
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 210 293 1.0E-06
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 65 290 1.0E-06
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 207 288 1.0E-06
sp|A8XSC1|NLK_CAEBR Serine/threonine kinase NLK OS=Caenorhabditis briggsae GN=lit-1 PE=3 SV=2 193 442 1.0E-06
sp|Q9NWZ3|IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens GN=IRAK4 PE=1 SV=1 62 296 1.0E-06
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 207 294 2.0E-06
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 207 308 2.0E-06
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 201 288 2.0E-06
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 189 380 2.0E-06
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 207 294 2.0E-06
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 201 288 2.0E-06
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 207 380 2.0E-06
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 189 380 2.0E-06
sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens GN=MAP2K2 PE=1 SV=1 206 297 2.0E-06
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 188 289 3.0E-06
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 207 307 3.0E-06
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 188 289 3.0E-06
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 207 294 3.0E-06
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 203 309 3.0E-06
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 207 292 3.0E-06
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 207 292 3.0E-06
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 207 292 3.0E-06
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 207 380 3.0E-06
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 207 380 4.0E-06
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 200 294 4.0E-06
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 207 294 4.0E-06
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 200 294 4.0E-06
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 200 294 4.0E-06
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 203 289 4.0E-06
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 207 380 4.0E-06
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 207 380 4.0E-06
sp|Q5Z9J0|MPK12_ORYSJ Mitogen-activated protein kinase 12 OS=Oryza sativa subsp. japonica GN=MPK12 PE=1 SV=2 191 294 4.0E-06
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 207 307 5.0E-06
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 210 360 6.0E-06
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 210 360 6.0E-06
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 210 360 7.0E-06
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 75 290 7.0E-06
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 207 296 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2636
MGDGPFGSGWTTVGHKMSAPSGSLGRVWEIEQELRERDAISAWDRDDDWPGVYRPPSRSFDAKRFDGSLIELGDL
GIGAFGSVDKIQHGGVALARKRITRTRGLTLSDLRQEALTMRKLDHCHVVKLVATYAPRPFELCLLIWPAALCSL
SSLLQDIECLRLGNGDREDIVQRLYGLHLRDDDAPAPPLGADDTTTYRFLCSLIGCLARALAYCHAKGVRHLDIK
PSNILLNPNRVYLADFGISQDVSDRDHTTIDGAPGTEKWRAPELHGSHGSSMQLSDIYSLGLVYLNIATVLYSSR
LADFEDSLRYSHCLCLDERLRIREEKVKKHLDGLSACCLATPRFALGHDGQETVRPRPLVTLIAQMLSRNPRSRP
SAEKADEKLSMLGGIYQIYHSDCCKRPARWMEDKWDKKLTMLASLKAKNEQQRQRILELEGKDETYEARIENAHL
AHKDRIDWLQKQLREAEDECRRLEKEKSGRKKSHARGYQGSSRSASRCTSQDSRANCAASSPPPILGKTLQVPMR
SAAQPWSRPAAAKSPPPRGRPGSCIETSLRPGPTRVAQAPRRPSPSESSTGYKLRSRGSGSRLPLPVTPVRCETP
ALGHDPSMSESSMASSIFSRRSIETAPTPAYGSPQLQHPAANESSAEPQWTHLPAKPSMQPCHVAAPPNLGLSTV
PLSRRRRLGFAPEDIVDRTARPIVPTLQSTKSWADVAKSSAIGKVRITAVK*
Coding >OphauB2|2636
ATGGGCGACGGGCCCTTTGGTAGTGGCTGGACTACCGTCGGCCACAAAATGTCGGCACCGAGCGGGTCCCTCGGA
CGCGTCTGGGAGATTGAGCAAGAGCTTCGCGAACGCGACGCCATCTCAGCATGGGATCGAGACGACGACTGGCCC
GGCGTATACCGCCCTCCTTCGCGAAGCTTTGACGCCAAGCGCTTTGATGGCAGCCTCATTGAGCTGGGTGACCTC
GGGATTGGCGCATTTGGCTCGGTAGACAAGATCCAACACGGTGGCGTCGCCCTGGCTCGCAAGCGCATCACACGC
ACCCGCGGACTGACGCTCAGCGACCTGCGCCAAGAGGCATTGACCATGCGCAAGCTCGACCACTGCCACGTTGTC
AAGCTGGTTGCCACGTACGCTCCGCGCCCTTTTGAACTATGTCTGCTTATCTGGCCCGCGGCGCTCTGCAGCTTG
AGCTCGCTGCTCCAAGACATTGAGTGCCTGCGCCTTGGCAATGGCGATCGCGAGGACATTGTGCAGAGGCTGTAC
GGGCTGCATCTCAGAGACGACGACGCTCCCGCACCGCCGCTTGGCGCAGACGACACTACCACCTACCGCTTTCTC
TGCTCCCTCATAGGCTGTCTTGCCCGCGCCTTGGCTTACTGCCATGCCAAGGGCGTTCGCCACCTCGACATCAAG
CCGTCCAATATCCTGCTCAACCCCAACCGCGTCTATCTGGCCGACTTTGGCATTTCGCAGGACGTCAGTGACCGC
GACCACACAACCATTGACGGCGCCCCAGGCACCGAGAAGTGGCGCGCCCCTGAACTCCATGGCAGCCATGGCTCC
AGCATGCAACTTTCAGATATTTATTCTCTGGGCCTCGTATACTTGAACATTGCCACAGTGCTCTACAGCAGCCGA
CTGGCCGACTTTGAAGATAGTCTTCGCTATTCGCACTGTCTCTGTCTCGACGAACGCCTTCGGATCCGTGAGGAA
AAGGTCAAGAAGCATCTCGATGGCCTTTCTGCCTGTTGCCTTGCAACGCCGCGCTTTGCCCTTGGACACGATGGC
CAAGAGACGGTGCGCCCGCGGCCACTAGTCACACTCATTGCACAAATGCTATCACGCAACCCACGAAGCCGACCA
TCTGCCGAAAAGGCTGACGAGAAGCTTTCCATGCTCGGCGGCATCTATCAGATATATCATTCCGACTGCTGCAAA
CGGCCTGCTCGGTGGATGGAGGACAAGTGGGACAAGAAGCTGACAATGCTGGCCAGTCTCAAGGCCAAAAACGAG
CAGCAGCGCCAGAGGATTCTGGAGCTAGAGGGCAAAGACGAGACATACGAGGCGCGCATTGAAAACGCCCACCTG
GCGCACAAGGACCGCATTGATTGGCTGCAGAAGCAGCTGCGAGAGGCAGAGGATGAGTGCCGGCGACTGGAAAAA
GAAAAAAGCGGGCGCAAAAAGAGCCATGCCCGCGGCTACCAGGGGTCTTCTCGCTCCGCCTCGCGGTGTACAAGT
CAAGACAGCAGAGCAAATTGTGCTGCTTCCAGCCCTCCCCCCATCTTGGGAAAGACACTACAAGTACCCATGAGG
TCTGCGGCGCAGCCATGGTCCCGTCCAGCCGCGGCCAAATCTCCGCCACCCAGAGGACGGCCTGGGTCATGCATC
GAGACATCGCTGAGGCCTGGGCCAACCCGCGTGGCCCAAGCGCCGCGTCGACCCTCGCCCTCGGAAAGCTCGACT
GGGTACAAGCTTCGCTCCCGGGGCTCTGGCTCCAGACTGCCGCTGCCTGTGACCCCAGTCCGATGTGAAACACCA
GCTCTAGGCCACGATCCGAGCATGTCGGAGAGCAGCATGGCATCATCAATCTTTTCTCGCCGTAGCATTGAGACG
GCGCCGACGCCGGCATATGGTAGCCCACAGCTGCAACATCCTGCAGCGAATGAGTCGAGTGCCGAGCCCCAATGG
ACGCACCTACCCGCCAAGCCATCAATGCAGCCGTGCCATGTAGCGGCGCCTCCAAACCTGGGGCTCTCGACAGTG
CCTTTGTCTCGAAGGAGGAGACTGGGCTTTGCACCTGAGGATATTGTCGACAGGACGGCACGGCCTATAGTGCCG
ACGCTGCAGTCTACCAAAAGCTGGGCCGACGTGGCCAAGTCTAGTGCCATTGGCAAGGTGAGGATTACGGCGGTG
AAATGA
Transcript >OphauB2|2636
ATGGGCGACGGGCCCTTTGGTAGTGGCTGGACTACCGTCGGCCACAAAATGTCGGCACCGAGCGGGTCCCTCGGA
CGCGTCTGGGAGATTGAGCAAGAGCTTCGCGAACGCGACGCCATCTCAGCATGGGATCGAGACGACGACTGGCCC
GGCGTATACCGCCCTCCTTCGCGAAGCTTTGACGCCAAGCGCTTTGATGGCAGCCTCATTGAGCTGGGTGACCTC
GGGATTGGCGCATTTGGCTCGGTAGACAAGATCCAACACGGTGGCGTCGCCCTGGCTCGCAAGCGCATCACACGC
ACCCGCGGACTGACGCTCAGCGACCTGCGCCAAGAGGCATTGACCATGCGCAAGCTCGACCACTGCCACGTTGTC
AAGCTGGTTGCCACGTACGCTCCGCGCCCTTTTGAACTATGTCTGCTTATCTGGCCCGCGGCGCTCTGCAGCTTG
AGCTCGCTGCTCCAAGACATTGAGTGCCTGCGCCTTGGCAATGGCGATCGCGAGGACATTGTGCAGAGGCTGTAC
GGGCTGCATCTCAGAGACGACGACGCTCCCGCACCGCCGCTTGGCGCAGACGACACTACCACCTACCGCTTTCTC
TGCTCCCTCATAGGCTGTCTTGCCCGCGCCTTGGCTTACTGCCATGCCAAGGGCGTTCGCCACCTCGACATCAAG
CCGTCCAATATCCTGCTCAACCCCAACCGCGTCTATCTGGCCGACTTTGGCATTTCGCAGGACGTCAGTGACCGC
GACCACACAACCATTGACGGCGCCCCAGGCACCGAGAAGTGGCGCGCCCCTGAACTCCATGGCAGCCATGGCTCC
AGCATGCAACTTTCAGATATTTATTCTCTGGGCCTCGTATACTTGAACATTGCCACAGTGCTCTACAGCAGCCGA
CTGGCCGACTTTGAAGATAGTCTTCGCTATTCGCACTGTCTCTGTCTCGACGAACGCCTTCGGATCCGTGAGGAA
AAGGTCAAGAAGCATCTCGATGGCCTTTCTGCCTGTTGCCTTGCAACGCCGCGCTTTGCCCTTGGACACGATGGC
CAAGAGACGGTGCGCCCGCGGCCACTAGTCACACTCATTGCACAAATGCTATCACGCAACCCACGAAGCCGACCA
TCTGCCGAAAAGGCTGACGAGAAGCTTTCCATGCTCGGCGGCATCTATCAGATATATCATTCCGACTGCTGCAAA
CGGCCTGCTCGGTGGATGGAGGACAAGTGGGACAAGAAGCTGACAATGCTGGCCAGTCTCAAGGCCAAAAACGAG
CAGCAGCGCCAGAGGATTCTGGAGCTAGAGGGCAAAGACGAGACATACGAGGCGCGCATTGAAAACGCCCACCTG
GCGCACAAGGACCGCATTGATTGGCTGCAGAAGCAGCTGCGAGAGGCAGAGGATGAGTGCCGGCGACTGGAAAAA
GAAAAAAGCGGGCGCAAAAAGAGCCATGCCCGCGGCTACCAGGGGTCTTCTCGCTCCGCCTCGCGGTGTACAAGT
CAAGACAGCAGAGCAAATTGTGCTGCTTCCAGCCCTCCCCCCATCTTGGGAAAGACACTACAAGTACCCATGAGG
TCTGCGGCGCAGCCATGGTCCCGTCCAGCCGCGGCCAAATCTCCGCCACCCAGAGGACGGCCTGGGTCATGCATC
GAGACATCGCTGAGGCCTGGGCCAACCCGCGTGGCCCAAGCGCCGCGTCGACCCTCGCCCTCGGAAAGCTCGACT
GGGTACAAGCTTCGCTCCCGGGGCTCTGGCTCCAGACTGCCGCTGCCTGTGACCCCAGTCCGATGTGAAACACCA
GCTCTAGGCCACGATCCGAGCATGTCGGAGAGCAGCATGGCATCATCAATCTTTTCTCGCCGTAGCATTGAGACG
GCGCCGACGCCGGCATATGGTAGCCCACAGCTGCAACATCCTGCAGCGAATGAGTCGAGTGCCGAGCCCCAATGG
ACGCACCTACCCGCCAAGCCATCAATGCAGCCGTGCCATGTAGCGGCGCCTCCAAACCTGGGGCTCTCGACAGTG
CCTTTGTCTCGAAGGAGGAGACTGGGCTTTGCACCTGAGGATATTGTCGACAGGACGGCACGGCCTATAGTGCCG
ACGCTGCAGTCTACCAAAAGCTGGGCCGACGTGGCCAAGTCTAGTGCCATTGGCAAGGTGAGGATTACGGCGGTG
AAATGA
Gene >OphauB2|2636
ATGGGCGACGGGCCCTTTGGTAGTGGCTGGACTACCGTCGGCCACAAAATGTCGGCACCGAGCGGGTCCCTCGGA
CGCGTCTGGGAGATTGAGCAAGAGCTTCGCGAACGCGACGCCATCTCAGCATGGGATCGAGACGACGACTGGCCC
GGCGTGTAAGCTAGCCGTGCCATTTCGCCCATGCGCGGCTTCTGACTAGACCTAGATACCGCCCTCCTTCGCGAA
GCTTTGACGCCAAGCGCTTTGATGGCAGCCTCATTGAGCTGGGTGACCTCGGGATTGGCGCATTTGGCTCGGTAG
ACAAGATCCAACACGGTGGCGTCGCCCTGGCTCGCAAGCGCATCACACGCACCCGCGGACTGACGCTCAGCGACC
TGCGCCAAGAGGCATTGACCATGCGCAAGCTCGACCACTGCCACGTTGTCAAGCTGGTTGCCACGTACGCTCCGC
GCCCTTTTGAACTATGTCTGCTTATCTGGCCCGCGGCGCTCTGCAGCTTGAGCTCGCTGCTCCAAGACATTGAGT
GCCTGCGCCTTGGCAATGGCGATCGCGAGGACATTGTGCAGAGGCTGTACGGGCTGCATCTCAGAGACGACGACG
CTCCCGCACCGCCGCTTGGCGCAGACGACACTACCACCTACCGCTTTCTCTGCTCCCTCATAGGCTGTCTTGCCC
GCGCCTTGGCTTACTGCCATGCCAAGGGCGTTCGCCACCTCGACATCAAGCCGTCCAATATCCTGCTCAACCCCA
ACCGCGTCTATCTGGCCGACTTTGGCATTTCGCAGGACGTCAGTGACCGCGACCACACAACCATTGACGGCGCCC
CAGGCACCGAGAAGTGGCGCGCCCCTGAACTCCATGGCAGCCATGGCTCCAGCATGCAACTTTCAGATATTTATT
CTCTGGGCCTCGTATACTTGAACATTGCCACAGTGCTCTACAGCAGCCGACTGGCCGACTTTGAAGATAGTCTTC
GCTATTCGCACTGTCTCTGTCTCGACGAACGCCTTCGGATCCGTGAGGAAAAGGTCAAGAAGCATCTCGATGGCC
TTTCTGCCTGTTGCCTTGCAACGCCGCGCTTTGCCCTTGGACACGATGGCCAAGAGACGGTGCGCCCGCGGCCAC
TAGTCACACTCATTGCACAAATGCTATCACGCAACCCACGAAGCCGACCATCTGCCGAAAAGGCTGACGAGAAGC
TTTCCATGCTCGGCGGCATCTATCAGATATATCATTCCGACTGCTGCAAACGGCCTGCTCGGTGGATGGAGGACA
AGTGGGACAAGAAGCTGACAATGCTGGCCAGTCTCAAGGCCAAAAACGAGCAGCAGCGCCAGAGGATTCTGGAGC
TAGAGGGCAAAGACGAGACATACGAGGCGCGCATTGAAAACGCCCACCTGGCGCACAAGGACCGCATTGATTGGC
TGCAGAAGCAGCTGCGAGAGGCAGAGGATGAGTGCCGGCGACTGGAAAAAGAAAAAAGCGGGCGCAAAAAGAGCC
ATGCCCGCGGCTACCAGGGGTCTTCTCGCTCCGCCTCGCGGTGTACAAGTCAAGACAGCAGAGCAAATTGTGCTG
CTTCCAGCCCTCCCCCCATCTTGGGAAAGACACTACAAGTACCCATGAGGTCTGCGGCGCAGCCATGGTCCCGTC
CAGCCGCGGCCAAATCTCCGCCACCCAGAGGACGGCCTGGGTCATGCATCGAGACATCGCTGAGGCCTGGGCCAA
CCCGCGTGGCCCAAGCGCCGCGTCGACCCTCGCCCTCGGAAAGCTCGACTGGGTACAAGCTTCGCTCCCGGGGCT
CTGGCTCCAGACTGCCGCTGCCTGTGACCCCAGTCCGATGTGAAACACCAGCTCTAGGCCACGATCCGAGCATGT
CGGAGAGCAGCATGGCATCATCAATCTTTTCTCGCCGTAGCATTGAGACGGCGCCGACGCCGGCATATGGTAGCC
CACAGCTGCAACATCCTGCAGCGAATGAGTCGAGTGCCGAGCCCCAATGGACGCACCTACCCGCCAAGCCATCAA
TGCAGCCGTGCCATGTAGCGGCGCCTCCAAACCTGGGGCTCTCGACAGTGCCTTTGTCTCGAAGGAGGAGACTGG
GCTTTGCACCTGAGGATATTGTCGACAGGACGGCACGGCCTATAGTGCCGACGCTGCAGTCTACCAAAAGCTGGG
CCGACGTGGCCAAGTCTAGTGCCATTGGCAAGGTGAGGATTACGGCGGTGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail