Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|263
Gene name
LocationContig_10:285938..289912
Strand-
Gene length (bp)3974
Transcript length (bp)3921
Coding sequence length (bp)3921
Protein length (aa) 1307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 7.1E-76 15 436
PF07993 NAD_binding_4 Male sterility protein 6.0E-61 678 919
PF00106 adh_short short chain dehydrogenase 2.1E-48 1064 1256
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 6.5E-36 1070 1286
PF08659 KR KR domain 2.6E-13 1067 1231
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.1E-09 676 890
PF00550 PP-binding Phosphopantetheine attachment site 1.4E-12 567 628

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 22 966 1.0E-121
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 13 1041 1.0E-77
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 13 920 3.0E-76
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 24 1041 6.0E-74
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 13 965 7.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 22 966 1.0E-121
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 13 1041 1.0E-77
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 13 920 3.0E-76
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 24 1041 6.0E-74
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 13 965 7.0E-73
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 14 657 3.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 8 635 6.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 10 624 3.0E-70
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 13 925 4.0E-70
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 14 657 8.0E-69
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 7 615 6.0E-68
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 10 643 1.0E-66
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 7 615 2.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 7 642 2.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 14 640 4.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 6 656 4.0E-65
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 13 642 4.0E-65
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 10 624 6.0E-65
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 10 643 9.0E-65
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 5 604 2.0E-64
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 8 629 4.0E-64
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2 643 2.0E-63
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 8 647 3.0E-63
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 14 661 3.0E-63
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2 643 4.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 7 625 7.0E-63
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 13 660 8.0E-63
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 676 1038 1.0E-62
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 8 647 2.0E-62
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 10 644 2.0E-62
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2 643 3.0E-62
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 8 643 2.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 7 624 2.0E-61
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 13 624 5.0E-61
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 10 971 9.0E-61
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 10 647 1.0E-60
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 16 643 3.0E-60
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 12 643 4.0E-60
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 10 626 4.0E-60
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 14 626 5.0E-60
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 7 608 5.0E-60
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 6 625 1.0E-59
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 6 625 5.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 14 642 5.0E-58
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 8 643 6.0E-58
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 8 643 6.0E-58
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 7 647 7.0E-58
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 8 642 9.0E-58
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 18 608 1.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 6 643 1.0E-57
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 7 634 1.0E-57
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 6 647 2.0E-57
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 8 635 2.0E-57
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 8 625 4.0E-57
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 8 635 5.0E-57
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 13 636 6.0E-57
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 6 625 7.0E-57
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 7 607 7.0E-57
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 8 624 1.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 6 657 1.0E-56
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1 646 1.0E-56
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 18 608 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 13 625 2.0E-56
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 7 625 2.0E-56
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 13 625 9.0E-56
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 18 604 2.0E-55
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 13 624 4.0E-55
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 7 624 7.0E-55
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 6 645 1.0E-54
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 10 609 1.0E-53
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 7 647 2.0E-53
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 10 1002 4.0E-53
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 7 626 8.0E-53
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 14 625 9.0E-53
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 10 609 4.0E-52
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 10 607 9.0E-52
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 8 639 3.0E-51
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 7 625 3.0E-51
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 7 626 8.0E-51
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 14 625 1.0E-50
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 6 744 3.0E-50
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 13 637 7.0E-50
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 10 625 1.0E-49
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 22 968 3.0E-49
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 13 636 6.0E-49
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 8 624 6.0E-49
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 6 744 9.0E-49
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 13 651 7.0E-48
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 14 605 1.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 8 623 2.0E-47
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 7 625 2.0E-46
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 10 625 4.0E-46
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 6 625 1.0E-45
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 6 635 1.0E-44
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 4 630 1.0E-44
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 14 476 8.0E-44
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 13 480 2.0E-43
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 1061 1301 2.0E-43
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 1061 1301 7.0E-43
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 1061 1301 7.0E-43
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 1058 1301 8.0E-43
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 1061 1301 9.0E-43
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 1061 1301 9.0E-43
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 1061 1301 1.0E-42
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 1061 1301 1.0E-42
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 1061 1301 1.0E-42
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 13 684 2.0E-42
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 13 684 2.0E-42
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 7 608 2.0E-42
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 21 537 3.0E-41
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 1061 1305 9.0E-41
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 13 631 2.0E-40
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 1061 1305 2.0E-40
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 1061 1301 2.0E-39
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 7 615 3.0E-39
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 1064 1301 1.0E-38
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 1064 1301 1.0E-38
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 1064 1306 2.0E-38
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 16 607 2.0E-38
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 5 607 7.0E-37
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 7 640 3.0E-36
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 12 605 9.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 14 610 7.0E-35
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 5 609 2.0E-34
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 18 608 2.0E-34
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 14 626 1.0E-33
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 14 626 1.0E-33
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 13 596 3.0E-33
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 13 596 3.0E-33
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 16 596 7.0E-33
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 8 536 1.0E-32
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 22 596 2.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 18 536 2.0E-32
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 14 650 3.0E-32
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 165 617 5.0E-32
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 165 617 5.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 18 536 6.0E-32
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 165 617 6.0E-32
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 8 536 7.0E-32
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 31 626 2.0E-31
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 19 625 3.0E-31
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 18 536 4.0E-31
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 18 536 6.0E-31
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 14 605 7.0E-31
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 14 605 7.0E-31
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 18 536 7.0E-31
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 16 596 5.0E-30
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 8 536 9.0E-30
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 14 596 9.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 18 536 2.0E-29
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 13 687 3.0E-29
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 34 648 3.0E-29
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 10 625 4.0E-29
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 8 536 5.0E-29
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 8 536 5.0E-29
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 8 536 5.0E-29
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 14 653 5.0E-29
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 8 536 6.0E-29
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 163 901 8.0E-29
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 647 9.0E-29
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 22 536 1.0E-28
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 22 536 3.0E-28
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 9 640 6.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 18 536 7.0E-28
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 22 536 7.0E-28
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 13 678 1.0E-27
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 18 536 1.0E-27
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 596 2.0E-27
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 608 2.0E-27
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 8 536 2.0E-27
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 35 536 2.0E-27
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 35 536 2.0E-27
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 14 536 4.0E-27
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 35 536 4.0E-27
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 14 651 7.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 22 481 8.0E-27
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 9 536 9.0E-27
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 7 660 1.0E-26
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 9 536 1.0E-26
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 9 536 1.0E-26
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 9 536 1.0E-26
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 9 536 1.0E-26
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 9 536 1.0E-26
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 9 536 1.0E-26
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 7 611 1.0E-26
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 7 611 2.0E-26
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 34 624 2.0E-26
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 13 637 4.0E-26
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 18 536 9.0E-26
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 30 607 2.0E-25
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 13 626 3.0E-25
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 1058 1286 8.0E-25
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 18 531 9.0E-25
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 18 536 1.0E-24
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 18 536 1.0E-24
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 7 611 1.0E-24
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 10 626 2.0E-24
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 18 536 2.0E-24
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 13 536 2.0E-24
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 35 626 2.0E-24
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 18 536 3.0E-24
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 371 941 4.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 18 536 4.0E-24
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 18 536 4.0E-24
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 14 536 4.0E-24
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 8 536 4.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 9 536 5.0E-24
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 18 536 5.0E-24
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 14 624 6.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 18 536 6.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 18 536 6.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 18 536 6.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 18 536 6.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 18 536 6.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 18 536 6.0E-24
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 18 536 1.0E-23
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 18 536 1.0E-23
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 18 536 1.0E-23
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 10 536 2.0E-23
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1 536 2.0E-23
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 9 536 4.0E-23
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 79 476 4.0E-23
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 1064 1253 6.0E-23
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 1064 1304 7.0E-23
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 1064 1304 7.0E-23
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 1065 1301 8.0E-23
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 1065 1301 8.0E-23
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 1062 1301 1.0E-22
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 32 613 2.0E-22
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 27 611 5.0E-22
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 1059 1283 2.0E-21
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 1061 1304 2.0E-21
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 1059 1283 3.0E-21
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 14 531 3.0E-21
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 16 613 3.0E-21
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 1065 1301 3.0E-21
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 1059 1283 4.0E-21
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 1065 1301 6.0E-21
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 1065 1301 9.0E-21
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 9 536 9.0E-21
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 1063 1304 1.0E-20
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 1065 1301 1.0E-20
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 1066 1301 1.0E-20
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 7 536 1.0E-20
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 1065 1301 2.0E-20
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 1058 1296 2.0E-20
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 1061 1304 2.0E-20
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 17 536 2.0E-20
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 18 536 3.0E-20
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 368 704 3.0E-20
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1064 1284 3.0E-20
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1064 1284 3.0E-20
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1064 1284 3.0E-20
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1064 1284 3.0E-20
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1064 1284 3.0E-20
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1064 1284 3.0E-20
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 9 536 5.0E-20
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 1064 1304 6.0E-20
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1061 1284 8.0E-20
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 1061 1251 1.0E-19
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 1064 1257 2.0E-19
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 1064 1257 2.0E-19
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 1064 1301 2.0E-19
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 1061 1284 2.0E-19
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 1056 1304 3.0E-19
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 1067 1301 3.0E-19
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 9 536 4.0E-19
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 1058 1287 5.0E-19
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 1063 1284 5.0E-19
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 1063 1284 5.0E-19
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 651 895 6.0E-19
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 1064 1304 9.0E-19
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 1061 1251 9.0E-19
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 1061 1302 9.0E-19
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 1067 1301 1.0E-18
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 1063 1284 2.0E-18
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 1063 1284 2.0E-18
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 14 523 2.0E-18
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 1064 1293 3.0E-18
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 9 626 8.0E-18
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 1063 1253 8.0E-18
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 1061 1290 1.0E-17
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 1061 1251 1.0E-17
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 1061 1251 1.0E-17
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 651 895 1.0E-17
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 18 477 2.0E-17
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 1061 1284 2.0E-17
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 60 623 4.0E-17
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 1058 1267 5.0E-17
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 1058 1267 5.0E-17
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 1061 1300 5.0E-17
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 1060 1251 6.0E-17
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 1061 1251 6.0E-17
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 25 531 8.0E-17
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 1063 1300 9.0E-17
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 643 922 1.0E-16
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 1055 1283 1.0E-16
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 1067 1275 1.0E-16
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 1067 1275 1.0E-16
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 1061 1265 1.0E-16
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 7 513 1.0E-16
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 13 510 1.0E-16
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 13 510 1.0E-16
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 1035 1295 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 13 606 2.0E-16
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 3 523 2.0E-16
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 1064 1252 2.0E-16
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 1061 1240 2.0E-16
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 1064 1289 2.0E-16
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 1059 1300 2.0E-16
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 1060 1284 3.0E-16
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 1061 1264 3.0E-16
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 1061 1264 3.0E-16
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 656 901 4.0E-16
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 676 922 4.0E-16
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 1061 1290 5.0E-16
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 1058 1267 6.0E-16
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1065 1289 6.0E-16
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 1061 1290 6.0E-16
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 1058 1267 6.0E-16
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 30 485 7.0E-16
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 1017 1289 9.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 14 635 1.0E-15
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 5 531 1.0E-15
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 5 531 1.0E-15
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 1053 1255 1.0E-15
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 12 901 1.0E-15
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 1029 1289 1.0E-15
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 1061 1252 1.0E-15
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 30 481 1.0E-15
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 1061 1300 1.0E-15
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 1064 1253 2.0E-15
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 1061 1300 2.0E-15
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 1055 1249 2.0E-15
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 10 523 2.0E-15
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 1061 1284 2.0E-15
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 42 475 2.0E-15
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 590 901 2.0E-15
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 1061 1252 2.0E-15
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 1061 1300 3.0E-15
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 1064 1253 3.0E-15
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 1061 1240 3.0E-15
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 1061 1284 3.0E-15
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 1065 1267 4.0E-15
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 1064 1284 4.0E-15
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 1061 1245 4.0E-15
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 8 536 4.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 161 462 5.0E-15
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 10 531 5.0E-15
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 1061 1284 6.0E-15
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 1055 1249 6.0E-15
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 5 531 6.0E-15
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 177 531 6.0E-15
sp|P9WQ45|FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD25 PE=1 SV=1 32 475 6.0E-15
sp|P9WQ44|FAD25_MYCTO Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD25 PE=3 SV=1 32 475 6.0E-15
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 677 922 7.0E-15
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 32 476 7.0E-15
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 10 523 8.0E-15
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 1059 1253 8.0E-15
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 5 531 9.0E-15
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 5 531 9.0E-15
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 26 449 1.0E-14
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 1059 1253 1.0E-14
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 1055 1249 1.0E-14
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 1061 1251 1.0E-14
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 1061 1251 1.0E-14
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 16 531 1.0E-14
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 1061 1245 1.0E-14
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 1061 1257 1.0E-14
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 7 513 1.0E-14
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 34 477 2.0E-14
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 1061 1300 2.0E-14
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 3 523 2.0E-14
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 1064 1284 2.0E-14
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 671 904 2.0E-14
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 1040 1265 2.0E-14
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 1061 1252 2.0E-14
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 1059 1290 2.0E-14
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 31 476 2.0E-14
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 3 523 3.0E-14
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 1058 1282 3.0E-14
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 1065 1304 3.0E-14
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 1067 1304 3.0E-14
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 1059 1285 3.0E-14
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 1059 1253 3.0E-14
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 1053 1240 3.0E-14
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 1060 1284 3.0E-14
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 1061 1267 3.0E-14
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 1061 1240 4.0E-14
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 1063 1283 4.0E-14
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 1063 1283 4.0E-14
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 1061 1251 4.0E-14
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 1064 1289 4.0E-14
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 3 523 4.0E-14
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 1055 1249 4.0E-14
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 1059 1251 4.0E-14
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 7 476 4.0E-14
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 1061 1240 4.0E-14
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 1063 1284 5.0E-14
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 1055 1288 5.0E-14
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 1061 1300 6.0E-14
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 1064 1251 6.0E-14
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 1065 1289 7.0E-14
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 1064 1290 8.0E-14
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 1064 1301 8.0E-14
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 20 536 8.0E-14
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 1061 1251 8.0E-14
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 671 922 9.0E-14
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 1061 1251 9.0E-14
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 3 523 9.0E-14
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 16 531 1.0E-13
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 1061 1300 1.0E-13
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 1065 1264 1.0E-13
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 1061 1251 1.0E-13
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 673 919 1.0E-13
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 1058 1264 2.0E-13
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 1058 1264 2.0E-13
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 3 523 2.0E-13
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 3 523 2.0E-13
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 16 523 2.0E-13
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 10 523 2.0E-13
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 1061 1284 2.0E-13
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 1065 1251 3.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 14 523 3.0E-13
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 30 483 3.0E-13
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 1059 1293 3.0E-13
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 1059 1293 3.0E-13
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 20 536 3.0E-13
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 1064 1290 3.0E-13
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 1056 1251 3.0E-13
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 10 523 3.0E-13
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 154 531 3.0E-13
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 676 922 3.0E-13
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 35 476 4.0E-13
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 1059 1249 4.0E-13
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 1055 1231 4.0E-13
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 1056 1250 4.0E-13
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 1056 1252 4.0E-13
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 1060 1251 4.0E-13
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 1059 1249 4.0E-13
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 1061 1251 5.0E-13
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 16 531 5.0E-13
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 16 523 5.0E-13
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 1057 1266 5.0E-13
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 1061 1265 5.0E-13
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 1061 1251 5.0E-13
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 1043 1284 6.0E-13
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 1055 1249 6.0E-13
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 1060 1251 6.0E-13
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 10 523 6.0E-13
sp|P9WQ47|FAC23_MYCTU Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD23 PE=1 SV=1 28 480 6.0E-13
sp|P9WQ46|FAC23_MYCTO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD23 PE=3 SV=1 28 480 6.0E-13
sp|Q7TVK7|FAC23_MYCBO Probable long-chain-fatty-acid--CoA ligase FadD23 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD23 PE=3 SV=1 28 480 6.0E-13
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 1063 1264 6.0E-13
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 1064 1289 7.0E-13
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 1061 1248 8.0E-13
sp|B2HI05|FAC19_MYCMM Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 4 518 9.0E-13
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 30 477 9.0E-13
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 1060 1251 9.0E-13
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 1064 1278 9.0E-13
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 1064 1251 1.0E-12
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 1060 1250 1.0E-12
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 18 532 1.0E-12
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 1061 1251 1.0E-12
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 35 476 1.0E-12
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 1064 1284 1.0E-12
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 1065 1253 1.0E-12
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 25 476 1.0E-12
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 1061 1252 1.0E-12
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 29 479 1.0E-12
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 1061 1284 2.0E-12
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 673 926 2.0E-12
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 1061 1251 2.0E-12
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 1064 1289 2.0E-12
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 32 479 2.0E-12
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 1065 1259 2.0E-12
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 17 531 2.0E-12
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 1055 1249 2.0E-12
sp|P16232|DHI1_RAT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Rattus norvegicus GN=Hsd11b1 PE=1 SV=2 1049 1240 2.0E-12
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 13 550 2.0E-12
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 1061 1251 2.0E-12
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 1061 1298 2.0E-12
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 1061 1247 2.0E-12
sp|Q4WZ66|CHADH_ASPFU Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 1058 1288 2.0E-12
sp|D3J0Z1|CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 1058 1288 2.0E-12
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 1064 1251 2.0E-12
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 1049 1240 2.0E-12
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 32 535 3.0E-12
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 1064 1266 3.0E-12
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 1064 1266 3.0E-12
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 1061 1265 3.0E-12
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 1064 1286 3.0E-12
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 1064 1267 3.0E-12
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 1064 1267 3.0E-12
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 1064 1267 3.0E-12
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 1064 1267 3.0E-12
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 1064 1267 3.0E-12
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 1064 1267 3.0E-12
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 1060 1251 3.0E-12
sp|Q9BUT1|BDH2_HUMAN 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 1061 1300 3.0E-12
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 1065 1267 3.0E-12
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 1064 1266 3.0E-12
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 1064 1297 3.0E-12
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 29 536 3.0E-12
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 1061 1277 3.0E-12
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 32 479 4.0E-12
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 1063 1290 4.0E-12
sp|A1S7C8|ACSA_SHEAM Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 30 477 4.0E-12
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 1061 1252 4.0E-12
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 54 475 4.0E-12
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 1063 1243 4.0E-12
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 1055 1249 5.0E-12
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 16 531 5.0E-12
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 29 472 6.0E-12
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 30 477 6.0E-12
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 30 477 6.0E-12
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 15 484 6.0E-12
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 1061 1279 7.0E-12
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 1063 1243 7.0E-12
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 30 478 8.0E-12
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 1060 1251 8.0E-12
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 1061 1256 8.0E-12
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 1061 1256 8.0E-12
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 1061 1256 8.0E-12
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 1064 1284 9.0E-12
sp|Q5R7K0|HSDL1_PONAB Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Pongo abelii GN=HSDL1 PE=2 SV=1 1063 1256 9.0E-12
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 677 922 9.0E-12
sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 1063 1251 9.0E-12
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 33 477 1.0E-11
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 175 465 1.0E-11
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 16 472 1.0E-11
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 1063 1290 1.0E-11
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 1045 1246 1.0E-11
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 1061 1251 1.0E-11
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 1058 1264 1.0E-11
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 6 489 1.0E-11
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 1059 1249 1.0E-11
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 1061 1252 1.0E-11
sp|P0CG22|DR4L1_HUMAN Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 1060 1251 1.0E-11
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 30 478 1.0E-11
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 1063 1255 1.0E-11
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 1061 1272 1.0E-11
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 1061 1252 1.0E-11
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 1061 1251 1.0E-11
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 1058 1249 1.0E-11
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 76 614 2.0E-11
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 30 478 2.0E-11
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 1063 1284 2.0E-11
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 1061 1284 2.0E-11
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 35 476 2.0E-11
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 1061 1295 2.0E-11
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 161 536 2.0E-11
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 177 536 2.0E-11
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 371 632 2.0E-11
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 1064 1255 3.0E-11
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 18 513 3.0E-11
sp|Q920P0|DCXR_RAT L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1 1061 1251 3.0E-11
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 10 531 3.0E-11
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 1064 1249 3.0E-11
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 1065 1251 3.0E-11
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 29 477 4.0E-11
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 29 477 4.0E-11
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 1064 1289 4.0E-11
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 1031 1261 4.0E-11
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 1058 1264 4.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 8 428 1.0E-09
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 172 625 9.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 465 613 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|263
MAMMDTSKDMAALFVQQAQATPEAIALEDEAKTLTYGELDGETWALANRLRQHGVGREHLVGVLMSRSADYVIAA
LATLRAGGAYLVLELAYPPALLREVIKDANPTVIITQEAHAGNIGAQVPVIVIDRLDAQAAGVXXXXXXQHQHQQ
QHPVVAAGTEIKAPLPDEQDVERLAFVSYSSGTTGRPKGIANSHRAALISYERRFRLRDLGPGDRVACNVFFVWE
MLRPLLRGATTVAVPDAASFDPPALVAFLAARQITDTLMTPSLLTTVLARHPDLGQALPRLESLWLNGEVVPREL
CRRVLKALPATSIFNVYSASETHEVAAGEIGQCLESTDDDCHVCPVGAPLDAQHTYVLDAAGNQVGPGVVGELFV
GGDTLARGYLNLPETTAKAFQMDPFDGRAGARMYRTGDVARLLASGTLEISGRVGGMIKTRGYSIEPGLVERTIV
KQLAVQDCAVVAHGDGLEKQLVAYVVVDARAAGKRTVLVVHDSGHSPVARRALMDHLAAYMIPPLWVVLDALPTS
GVSGKIDLKALPGPPSPMTPRSASKAAGKQQDHEASVRMDIVARHWGAALGLAHDSLSPHHNFFDLGGHSLMLAD
LASRLARALNFSIPLVALAAAPTLQGHVDAVRAARDGHTAAVQADLPAVLRADCQLPEEICSNGTPLCRLDDATH
VFLTGTTGYLGAFLLKTLLEQSSAQILCLVRFTEPTPDLRPAGLARIRKNLVDLGLWQDAMLDRIDVVPGNLARN
RLGLSPDAFDALAARVQVVFHAAAAVNLVYPYAALRNANVGGTREVLRLAAQAGATVHHVSTNGVLPPNPDGWCE
DAMIDIEHVPHQLADGYGQTKWVAEMLVYEAGRRGIPVRVYRPGTISGHSVTGSANTYDLLTALIVESLHLGCAP
HVPGWLAEMTPVDFVSQAIVTLANHCHLSRRLFHLGHACPPPASHVFAVLARLGYPTSPLPWDQWVARWTKHRAF
RDDPFTVEILRGGMPTQQGLVSAPVLKNDETRKTLASYGLDWPQMDEALWVTYTRHFFARGWLPHPPPRPLLNTT
NGTTPPTLKPLAGKVAIVTGASSGMGAAVAIHLAAAGAHVALAARRKDALQTIQTQCRAVSPSSKIISVPTDVTC
KAQVDALVHQTRTSLGDIDFLITCAGVMYFTLMANARSLEWDRTVDVNCKGLLHCLAATLPGFLSRRTGHIVALS
SDAGRKVFAGLGVYSASKFFVEATLQALRLETAASGLRVSSVQPGNVDTPLLALSTDAEALQQHGQPSGAKILAA
DDVARAIVFALEQPEHVAVNEILIEPREEPI*
Coding >OphauB2|263
ATGGCCATGATGGATACTAGCAAGGACATGGCGGCGCTCTTTGTGCAGCAAGCGCAGGCGACGCCCGAGGCGATT
GCACTCGAGGACGAGGCCAAGACGCTCACGTATGGCGAGCTGGATGGCGAGACGTGGGCGCTGGCGAACCGTCTG
CGGCAGCATGGGGTTGGGCGCGAGCACCTGGTGGGCGTGCTCATGAGCCGCAGCGCAGACTATGTAATTGCCGCC
TTGGCCACGCTGCGGGCGGGCGGCGCGTATCTGGTGCTTGAGCTGGCGTATCCGCCGGCGCTGCTTCGCGAGGTG
ATTAAGGATGCGAATCCAACGGTTATTATTACGCAAGAGGCACATGCGGGAAACATTGGGGCGCAAGTGCCCGTT
ATTGTCATTGACAGGCTCGACGCGCAGGCAGCTGGCGTTTNNNNNNNNNNNNNNNNGCAGCATCAACATCAGCAG
CAGCACCCCGTCGTTGCTGCAGGGACGGAAATCAAGGCGCCTCTGCCAGACGAACAAGACGTGGAGCGCCTCGCC
TTTGTCTCCTACTCGTCTGGCACAACTGGGCGCCCCAAGGGCATTGCAAACTCGCACCGCGCAGCCCTCATCTCG
TACGAGCGGCGCTTCCGGCTGCGCGACTTGGGCCCGGGCGACCGCGTGGCGTGTAATGTGTTTTTTGTATGGGAG
ATGCTGCGGCCGCTGCTGCGCGGCGCCACCACGGTTGCCGTGCCCGACGCAGCCAGCTTTGACCCGCCGGCGCTG
GTGGCCTTTTTGGCGGCGCGGCAAATCACCGACACGCTCATGACGCCGTCGCTGCTCACCACTGTTTTGGCGCGG
CATCCCGACCTGGGCCAGGCGCTGCCACGGCTGGAATCGCTGTGGCTCAATGGCGAGGTGGTGCCGCGGGAGCTG
TGCCGACGGGTGCTCAAGGCGTTGCCGGCGACGAGCATCTTCAACGTCTACAGCGCAAGCGAGACGCACGAGGTA
GCGGCGGGGGAAATTGGGCAGTGTCTGGAAAGCACCGACGACGACTGCCACGTGTGTCCTGTGGGGGCGCCGCTC
GACGCTCAGCACACGTATGTGCTCGACGCGGCGGGCAACCAAGTCGGGCCCGGCGTGGTGGGCGAGCTCTTTGTA
GGCGGCGACACGCTGGCGCGCGGATACCTCAACCTGCCCGAGACGACGGCCAAGGCGTTCCAAATGGACCCGTTT
GACGGGCGGGCCGGGGCGCGCATGTACCGCACGGGCGACGTGGCGCGGCTACTGGCGTCGGGGACGCTGGAGATT
TCGGGGCGGGTGGGCGGCATGATCAAGACGCGCGGCTACTCGATTGAGCCGGGGCTGGTGGAGCGCACCATTGTC
AAGCAGCTGGCGGTGCAAGACTGTGCCGTGGTGGCGCATGGCGACGGGCTGGAGAAGCAGCTGGTGGCGTATGTG
GTGGTGGATGCTCGGGCGGCGGGAAAGCGCACGGTGCTTGTGGTGCATGATTCGGGGCATAGTCCGGTTGCGCGG
CGAGCCCTCATGGACCATTTGGCGGCCTACATGATTCCGCCGCTGTGGGTGGTGCTGGACGCGCTGCCCACGAGT
GGCGTGTCGGGCAAGATTGACCTCAAGGCGCTGCCTGGGCCGCCGTCGCCCATGACGCCGCGCTCGGCCAGCAAG
GCGGCTGGCAAGCAGCAGGACCACGAGGCCAGTGTGCGCATGGACATTGTGGCGCGGCACTGGGGCGCGGCGCTG
GGTCTTGCGCATGATAGCCTCTCGCCTCACCACAACTTTTTCGATCTCGGCGGCCACTCGCTCATGCTTGCCGAC
TTGGCCTCGCGACTGGCGCGTGCCCTCAACTTTTCCATTCCCCTTGTTGCTCTTGCTGCTGCGCCCACTCTGCAG
GGCCATGTGGATGCCGTGCGCGCCGCCCGCGACGGCCACACTGCCGCCGTGCAGGCCGACTTGCCCGCCGTCTTG
CGCGCCGACTGCCAGCTGCCCGAGGAGATTTGCTCCAACGGCACGCCCCTATGCCGCCTCGACGATGCCACTCAT
GTGTTCTTGACAGGCACCACGGGCTACCTCGGAGCCTTTCTCCTCAAGACGCTGCTGGAGCAGAGTTCGGCGCAA
ATCCTCTGTCTGGTGCGCTTCACCGAACCCACGCCCGACTTGCGCCCTGCCGGCCTGGCGCGCATCCGCAAGAAT
CTCGTCGACCTGGGCCTCTGGCAAGACGCCATGCTGGACCGCATCGACGTGGTGCCCGGCAACCTGGCGCGCAAC
CGACTAGGTCTCTCGCCCGACGCCTTTGACGCCCTGGCTGCGCGCGTGCAAGTCGTCTTCCACGCCGCCGCCGCC
GTCAACCTCGTCTATCCCTATGCCGCCCTGCGCAACGCCAATGTCGGCGGCACGCGCGAGGTGCTGCGCTTAGCT
GCCCAGGCTGGCGCAACAGTCCACCACGTCTCTACCAATGGCGTTCTCCCACCCAACCCCGACGGCTGGTGCGAA
GACGCCATGATTGACATTGAGCACGTCCCGCACCAACTCGCCGACGGCTACGGCCAGACCAAATGGGTGGCGGAA
ATGCTCGTCTACGAAGCCGGCCGCCGCGGCATCCCCGTGCGTGTCTACCGCCCCGGCACCATTAGCGGCCACAGC
GTCACCGGATCCGCAAACACCTATGACCTGCTCACCGCCCTCATTGTCGAGTCGCTGCATCTCGGCTGCGCGCCA
CACGTCCCCGGCTGGCTTGCTGAAATGACCCCCGTCGACTTTGTCAGCCAGGCCATTGTCACGCTGGCAAACCAC
TGCCACTTGTCCCGCCGCCTCTTCCACCTCGGCCATGCTTGCCCCCCGCCAGCCAGCCACGTCTTTGCCGTGCTC
GCCCGCCTCGGCTACCCAACCTCGCCGCTCCCCTGGGACCAGTGGGTTGCCCGCTGGACCAAGCACCGCGCCTTT
CGCGACGACCCGTTTACCGTGGAGATTCTCCGCGGCGGCATGCCCACCCAGCAAGGCCTCGTCTCTGCCCCCGTC
CTCAAAAACGACGAGACGCGTAAAACTCTCGCCTCGTACGGCCTCGACTGGCCGCAAATGGACGAGGCCCTCTGG
GTTACCTATACCCGCCATTTTTTCGCCCGCGGCTGGCTCCCCCATCCACCCCCCCGGCCTCTCCTCAACACCACC
AATGGCACCACCCCCCCAACCCTCAAACCCCTTGCCGGCAAAGTCGCCATCGTCACCGGCGCCTCTTCCGGCATG
GGCGCCGCCGTTGCCATTCATCTCGCCGCCGCCGGCGCACACGTCGCCCTCGCTGCACGCCGCAAAGACGCCCTC
CAAACCATCCAAACCCAATGCCGCGCCGTCTCTCCCTCTTCCAAAATAATCTCCGTCCCAACAGACGTCACCTGC
AAAGCCCAAGTCGACGCCCTCGTCCACCAAACTCGCACCTCCCTCGGCGACATTGATTTCTTAATCACCTGCGCC
GGCGTCATGTACTTTACCCTCATGGCCAATGCCCGCTCCCTCGAATGGGACCGCACCGTCGACGTCAACTGCAAG
GGCCTCTTGCACTGCCTCGCCGCCACCCTTCCTGGCTTCCTCTCCCGCCGCACCGGCCACATTGTCGCCCTCTCC
TCCGACGCGGGGCGCAAGGTCTTTGCCGGTCTGGGCGTCTACTCTGCCTCCAAGTTTTTTGTCGAGGCTACCCTC
CAGGCCCTGCGGCTCGAAACAGCTGCCTCGGGCTTGCGCGTCTCGTCGGTGCAGCCGGGAAATGTCGATACGCCG
CTTCTGGCCCTCTCTACTGACGCAGAGGCGCTGCAGCAACATGGCCAGCCGTCGGGCGCAAAAATCTTGGCGGCT
GACGATGTGGCGCGCGCAATAGTCTTTGCGCTGGAGCAGCCAGAGCATGTTGCCGTTAATGAGATTTTGATTGAG
CCGCGCGAGGAACCCATTTAG
Transcript >OphauB2|263
ATGGCCATGATGGATACTAGCAAGGACATGGCGGCGCTCTTTGTGCAGCAAGCGCAGGCGACGCCCGAGGCGATT
GCACTCGAGGACGAGGCCAAGACGCTCACGTATGGCGAGCTGGATGGCGAGACGTGGGCGCTGGCGAACCGTCTG
CGGCAGCATGGGGTTGGGCGCGAGCACCTGGTGGGCGTGCTCATGAGCCGCAGCGCAGACTATGTAATTGCCGCC
TTGGCCACGCTGCGGGCGGGCGGCGCGTATCTGGTGCTTGAGCTGGCGTATCCGCCGGCGCTGCTTCGCGAGGTG
ATTAAGGATGCGAATCCAACGGTTATTATTACGCAAGAGGCACATGCGGGAAACATTGGGGCGCAAGTGCCCGTT
ATTGTCATTGACAGGCTCGACGCGCAGGCAGCTGGCGTTTNNNNNNNNNNNNNNNNGCAGCATCAACATCAGCAG
CAGCACCCCGTCGTTGCTGCAGGGACGGAAATCAAGGCGCCTCTGCCAGACGAACAAGACGTGGAGCGCCTCGCC
TTTGTCTCCTACTCGTCTGGCACAACTGGGCGCCCCAAGGGCATTGCAAACTCGCACCGCGCAGCCCTCATCTCG
TACGAGCGGCGCTTCCGGCTGCGCGACTTGGGCCCGGGCGACCGCGTGGCGTGTAATGTGTTTTTTGTATGGGAG
ATGCTGCGGCCGCTGCTGCGCGGCGCCACCACGGTTGCCGTGCCCGACGCAGCCAGCTTTGACCCGCCGGCGCTG
GTGGCCTTTTTGGCGGCGCGGCAAATCACCGACACGCTCATGACGCCGTCGCTGCTCACCACTGTTTTGGCGCGG
CATCCCGACCTGGGCCAGGCGCTGCCACGGCTGGAATCGCTGTGGCTCAATGGCGAGGTGGTGCCGCGGGAGCTG
TGCCGACGGGTGCTCAAGGCGTTGCCGGCGACGAGCATCTTCAACGTCTACAGCGCAAGCGAGACGCACGAGGTA
GCGGCGGGGGAAATTGGGCAGTGTCTGGAAAGCACCGACGACGACTGCCACGTGTGTCCTGTGGGGGCGCCGCTC
GACGCTCAGCACACGTATGTGCTCGACGCGGCGGGCAACCAAGTCGGGCCCGGCGTGGTGGGCGAGCTCTTTGTA
GGCGGCGACACGCTGGCGCGCGGATACCTCAACCTGCCCGAGACGACGGCCAAGGCGTTCCAAATGGACCCGTTT
GACGGGCGGGCCGGGGCGCGCATGTACCGCACGGGCGACGTGGCGCGGCTACTGGCGTCGGGGACGCTGGAGATT
TCGGGGCGGGTGGGCGGCATGATCAAGACGCGCGGCTACTCGATTGAGCCGGGGCTGGTGGAGCGCACCATTGTC
AAGCAGCTGGCGGTGCAAGACTGTGCCGTGGTGGCGCATGGCGACGGGCTGGAGAAGCAGCTGGTGGCGTATGTG
GTGGTGGATGCTCGGGCGGCGGGAAAGCGCACGGTGCTTGTGGTGCATGATTCGGGGCATAGTCCGGTTGCGCGG
CGAGCCCTCATGGACCATTTGGCGGCCTACATGATTCCGCCGCTGTGGGTGGTGCTGGACGCGCTGCCCACGAGT
GGCGTGTCGGGCAAGATTGACCTCAAGGCGCTGCCTGGGCCGCCGTCGCCCATGACGCCGCGCTCGGCCAGCAAG
GCGGCTGGCAAGCAGCAGGACCACGAGGCCAGTGTGCGCATGGACATTGTGGCGCGGCACTGGGGCGCGGCGCTG
GGTCTTGCGCATGATAGCCTCTCGCCTCACCACAACTTTTTCGATCTCGGCGGCCACTCGCTCATGCTTGCCGAC
TTGGCCTCGCGACTGGCGCGTGCCCTCAACTTTTCCATTCCCCTTGTTGCTCTTGCTGCTGCGCCCACTCTGCAG
GGCCATGTGGATGCCGTGCGCGCCGCCCGCGACGGCCACACTGCCGCCGTGCAGGCCGACTTGCCCGCCGTCTTG
CGCGCCGACTGCCAGCTGCCCGAGGAGATTTGCTCCAACGGCACGCCCCTATGCCGCCTCGACGATGCCACTCAT
GTGTTCTTGACAGGCACCACGGGCTACCTCGGAGCCTTTCTCCTCAAGACGCTGCTGGAGCAGAGTTCGGCGCAA
ATCCTCTGTCTGGTGCGCTTCACCGAACCCACGCCCGACTTGCGCCCTGCCGGCCTGGCGCGCATCCGCAAGAAT
CTCGTCGACCTGGGCCTCTGGCAAGACGCCATGCTGGACCGCATCGACGTGGTGCCCGGCAACCTGGCGCGCAAC
CGACTAGGTCTCTCGCCCGACGCCTTTGACGCCCTGGCTGCGCGCGTGCAAGTCGTCTTCCACGCCGCCGCCGCC
GTCAACCTCGTCTATCCCTATGCCGCCCTGCGCAACGCCAATGTCGGCGGCACGCGCGAGGTGCTGCGCTTAGCT
GCCCAGGCTGGCGCAACAGTCCACCACGTCTCTACCAATGGCGTTCTCCCACCCAACCCCGACGGCTGGTGCGAA
GACGCCATGATTGACATTGAGCACGTCCCGCACCAACTCGCCGACGGCTACGGCCAGACCAAATGGGTGGCGGAA
ATGCTCGTCTACGAAGCCGGCCGCCGCGGCATCCCCGTGCGTGTCTACCGCCCCGGCACCATTAGCGGCCACAGC
GTCACCGGATCCGCAAACACCTATGACCTGCTCACCGCCCTCATTGTCGAGTCGCTGCATCTCGGCTGCGCGCCA
CACGTCCCCGGCTGGCTTGCTGAAATGACCCCCGTCGACTTTGTCAGCCAGGCCATTGTCACGCTGGCAAACCAC
TGCCACTTGTCCCGCCGCCTCTTCCACCTCGGCCATGCTTGCCCCCCGCCAGCCAGCCACGTCTTTGCCGTGCTC
GCCCGCCTCGGCTACCCAACCTCGCCGCTCCCCTGGGACCAGTGGGTTGCCCGCTGGACCAAGCACCGCGCCTTT
CGCGACGACCCGTTTACCGTGGAGATTCTCCGCGGCGGCATGCCCACCCAGCAAGGCCTCGTCTCTGCCCCCGTC
CTCAAAAACGACGAGACGCGTAAAACTCTCGCCTCGTACGGCCTCGACTGGCCGCAAATGGACGAGGCCCTCTGG
GTTACCTATACCCGCCATTTTTTCGCCCGCGGCTGGCTCCCCCATCCACCCCCCCGGCCTCTCCTCAACACCACC
AATGGCACCACCCCCCCAACCCTCAAACCCCTTGCCGGCAAAGTCGCCATCGTCACCGGCGCCTCTTCCGGCATG
GGCGCCGCCGTTGCCATTCATCTCGCCGCCGCCGGCGCACACGTCGCCCTCGCTGCACGCCGCAAAGACGCCCTC
CAAACCATCCAAACCCAATGCCGCGCCGTCTCTCCCTCTTCCAAAATAATCTCCGTCCCAACAGACGTCACCTGC
AAAGCCCAAGTCGACGCCCTCGTCCACCAAACTCGCACCTCCCTCGGCGACATTGATTTCTTAATCACCTGCGCC
GGCGTCATGTACTTTACCCTCATGGCCAATGCCCGCTCCCTCGAATGGGACCGCACCGTCGACGTCAACTGCAAG
GGCCTCTTGCACTGCCTCGCCGCCACCCTTCCTGGCTTCCTCTCCCGCCGCACCGGCCACATTGTCGCCCTCTCC
TCCGACGCGGGGCGCAAGGTCTTTGCCGGTCTGGGCGTCTACTCTGCCTCCAAGTTTTTTGTCGAGGCTACCCTC
CAGGCCCTGCGGCTCGAAACAGCTGCCTCGGGCTTGCGCGTCTCGTCGGTGCAGCCGGGAAATGTCGATACGCCG
CTTCTGGCCCTCTCTACTGACGCAGAGGCGCTGCAGCAACATGGCCAGCCGTCGGGCGCAAAAATCTTGGCGGCT
GACGATGTGGCGCGCGCAATAGTCTTTGCGCTGGAGCAGCCAGAGCATGTTGCCGTTAATGAGATTTTGATTGAG
CCGCGCGAGGAACCCATTTAG
Gene >OphauB2|263
ATGGCCATGATGGATACTAGCAAGGACATGGCGGCGCTCTTTGTGCAGCAAGCGCAGGCGACGCCCGAGGCGATT
GCACTCGAGGACGAGGCCAAGACGCTCACGTATGGCGAGCTGGATGGCGAGACGTGGGCGCTGGCGAACCGTCTG
CGGCAGCATGGGGTTGGGCGCGAGCACCTGGTGGGCGTGCTCATGAGCCGCAGCGCAGACTATGTAATTGCCGCC
TTGGCCACGCTGCGGGCGGGCGGCGCGTATCTGGTGCTTGAGCTGGCGTATCCGCCGGCGCTGCTTCGCGAGGTG
ATTAAGGATGCGAATCCAACGGTTATTATTACGCAAGAGGCACATGCGGGAAACATTGGGGCGCAAGTGCCCGTT
ATTGTCATTGACAGGCTCGACGCGCAGGCAGCTGGCGTTTNNNNNNNNNNNNNNNNGCAGCATCAACATCAGCAG
CAGCAGTAGGAGAAGCAGCAGCAGCAGCAGCAGCAAATGGCGCTGATTCTACATGCAGCCCCGTCGTTGCTGCAG
GGACGGAAATCAAGGCGCCTCTGCCAGACGAACAAGACGTGGAGCGCCTCGCCTTTGTCTCCTACTCGTCTGGCA
CAACTGGGCGCCCCAAGGGCATTGCAAACTCGCACCGCGCAGCCCTCATCTCGTACGAGCGGCGCTTCCGGCTGC
GCGACTTGGGCCCGGGCGACCGCGTGGCGTGTAATGTGTTTTTTGTATGGGAGATGCTGCGGCCGCTGCTGCGCG
GCGCCACCACGGTTGCCGTGCCCGACGCAGCCAGCTTTGACCCGCCGGCGCTGGTGGCCTTTTTGGCGGCGCGGC
AAATCACCGACACGCTCATGACGCCGTCGCTGCTCACCACTGTTTTGGCGCGGCATCCCGACCTGGGCCAGGCGC
TGCCACGGCTGGAATCGCTGTGGCTCAATGGCGAGGTGGTGCCGCGGGAGCTGTGCCGACGGGTGCTCAAGGCGT
TGCCGGCGACGAGCATCTTCAACGTCTACAGCGCAAGCGAGACGCACGAGGTAGCGGCGGGGGAAATTGGGCAGT
GTCTGGAAAGCACCGACGACGACTGCCACGTGTGTCCTGTGGGGGCGCCGCTCGACGCTCAGCACACGTATGTGC
TCGACGCGGCGGGCAACCAAGTCGGGCCCGGCGTGGTGGGCGAGCTCTTTGTAGGCGGCGACACGCTGGCGCGCG
GATACCTCAACCTGCCCGAGACGACGGCCAAGGCGTTCCAAATGGACCCGTTTGACGGGCGGGCCGGGGCGCGCA
TGTACCGCACGGGCGACGTGGCGCGGCTACTGGCGTCGGGGACGCTGGAGATTTCGGGGCGGGTGGGCGGCATGA
TCAAGACGCGCGGCTACTCGATTGAGCCGGGGCTGGTGGAGCGCACCATTGTCAAGCAGCTGGCGGTGCAAGACT
GTGCCGTGGTGGCGCATGGCGACGGGCTGGAGAAGCAGCTGGTGGCGTATGTGGTGGTGGATGCTCGGGCGGCGG
GAAAGCGCACGGTGCTTGTGGTGCATGATTCGGGGCATAGTCCGGTTGCGCGGCGAGCCCTCATGGACCATTTGG
CGGCCTACATGATTCCGCCGCTGTGGGTGGTGCTGGACGCGCTGCCCACGAGTGGCGTGTCGGGCAAGATTGACC
TCAAGGCGCTGCCTGGGCCGCCGTCGCCCATGACGCCGCGCTCGGCCAGCAAGGCGGCTGGCAAGCAGCAGGACC
ACGAGGCCAGTGTGCGCATGGACATTGTGGCGCGGCACTGGGGCGCGGCGCTGGGTCTTGCGCATGATAGCCTCT
CGCCTCACCACAACTTTTTCGATCTCGGCGGCCACTCGCTCATGCTTGCCGACTTGGCCTCGCGACTGGCGCGTG
CCCTCAACTTTTCCATTCCCCTTGTTGCTCTTGCTGCTGCGCCCACTCTGCAGGGCCATGTGGATGCCGTGCGCG
CCGCCCGCGACGGCCACACTGCCGCCGTGCAGGCCGACTTGCCCGCCGTCTTGCGCGCCGACTGCCAGCTGCCCG
AGGAGATTTGCTCCAACGGCACGCCCCTATGCCGCCTCGACGATGCCACTCATGTGTTCTTGACAGGCACCACGG
GCTACCTCGGAGCCTTTCTCCTCAAGACGCTGCTGGAGCAGAGTTCGGCGCAAATCCTCTGTCTGGTGCGCTTCA
CCGAACCCACGCCCGACTTGCGCCCTGCCGGCCTGGCGCGCATCCGCAAGAATCTCGTCGACCTGGGCCTCTGGC
AAGACGCCATGCTGGACCGCATCGACGTGGTGCCCGGCAACCTGGCGCGCAACCGACTAGGTCTCTCGCCCGACG
CCTTTGACGCCCTGGCTGCGCGCGTGCAAGTCGTCTTCCACGCCGCCGCCGCCGTCAACCTCGTCTATCCCTATG
CCGCCCTGCGCAACGCCAATGTCGGCGGCACGCGCGAGGTGCTGCGCTTAGCTGCCCAGGCTGGCGCAACAGTCC
ACCACGTCTCTACCAATGGCGTTCTCCCACCCAACCCCGACGGCTGGTGCGAAGACGCCATGATTGACATTGAGC
ACGTCCCGCACCAACTCGCCGACGGCTACGGCCAGACCAAATGGGTGGCGGAAATGCTCGTCTACGAAGCCGGCC
GCCGCGGCATCCCCGTGCGTGTCTACCGCCCCGGCACCATTAGCGGCCACAGCGTCACCGGATCCGCAAACACCT
ATGACCTGCTCACCGCCCTCATTGTCGAGTCGCTGCATCTCGGCTGCGCGCCACACGTCCCCGGCTGGCTTGCTG
AAATGACCCCCGTCGACTTTGTCAGCCAGGCCATTGTCACGCTGGCAAACCACTGCCACTTGTCCCGCCGCCTCT
TCCACCTCGGCCATGCTTGCCCCCCGCCAGCCAGCCACGTCTTTGCCGTGCTCGCCCGCCTCGGCTACCCAACCT
CGCCGCTCCCCTGGGACCAGTGGGTTGCCCGCTGGACCAAGCACCGCGCCTTTCGCGACGACCCGTTTACCGTGG
AGATTCTCCGCGGCGGCATGCCCACCCAGCAAGGCCTCGTCTCTGCCCCCGTCCTCAAAAACGACGAGACGCGTA
AAACTCTCGCCTCGTACGGCCTCGACTGGCCGCAAATGGACGAGGCCCTCTGGGTTACCTATACCCGCCATTTTT
TCGCCCGCGGCTGGCTCCCCCATCCACCCCCCCGGCCTCTCCTCAACACCACCAATGGCACCACCCCCCCAACCC
TCAAACCCCTTGCCGGCAAAGTCGCCATCGTCACCGGCGCCTCTTCCGGCATGGGCGCCGCCGTTGCCATTCATC
TCGCCGCCGCCGGCGCACACGTCGCCCTCGCTGCACGCCGCAAAGACGCCCTCCAAACCATCCAAACCCAATGCC
GCGCCGTCTCTCCCTCTTCCAAAATAATCTCCGTCCCAACAGACGTCACCTGCAAAGCCCAAGTCGACGCCCTCG
TCCACCAAACTCGCACCTCCCTCGGCGACATTGATTTCTTAATCACCTGCGCCGGCGTCATGTACTTTACCCTCA
TGGCCAATGCCCGCTCCCTCGAATGGGACCGCACCGTCGACGTCAACTGCAAGGGCCTCTTGCACTGCCTCGCCG
CCACCCTTCCTGGCTTCCTCTCCCGCCGCACCGGCCACATTGTCGCCCTCTCCTCCGACGCGGGGCGCAAGGTCT
TTGCCGGTCTGGGCGTCTACTCTGCCTCCAAGTTTTTTGTCGAGGCTACCCTCCAGGCCCTGCGGCTCGAAACAG
CTGCCTCGGGCTTGCGCGTCTCGTCGGTGCAGCCGGGAAATGTCGATACGCCGCTTCTGGCCCTCTCTACTGACG
CAGAGGCGCTGCAGCAACATGGCCAGCCGTCGGGCGCAAAAATCTTGGCGGCTGACGATGTGGCGCGCGCAATAG
TCTTTGCGCTGGAGCAGCCAGAGCATGTTGCCGTTAATGAGATTTTGATTGAGCCGCGCGAGGAACCCATTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail