Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2629
Gene name
LocationContig_185:27438..36430
Strand-
Gene length (bp)8992
Transcript length (bp)8736
Coding sequence length (bp)8736
Protein length (aa) 2912

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 1.1E-50 2582 2821
PF11640 TAN Telomere-length maintenance and DNA damage repair 4.1E-42 10 155
PF02260 FATC FATC domain 3.1E-11 2881 2910

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 655 2911 0.0E+00
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 43 2911 0.0E+00
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 543 2911 0.0E+00
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 3 2911 0.0E+00
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 852 2911 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 655 2911 0.0E+00
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 43 2911 0.0E+00
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 543 2911 0.0E+00
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 3 2911 0.0E+00
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 852 2911 0.0E+00
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 1733 2910 7.0E-167
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 1772 2910 3.0E-135
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 1772 2910 2.0E-134
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 9 501 4.0E-133
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 1726 2911 2.0E-132
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 1792 2910 4.0E-131
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 1726 2911 8.0E-131
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 1765 2911 2.0E-130
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 1596 2910 2.0E-121
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 1599 2910 4.0E-114
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 1807 2910 3.0E-112
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 2178 2910 1.0E-109
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 1840 2910 1.0E-103
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 1886 2910 5.0E-102
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 2181 2910 9.0E-100
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 2256 2907 5.0E-89
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 2343 2910 6.0E-56
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 2378 2907 5.0E-55
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 2380 2910 4.0E-54
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 2393 2910 6.0E-53
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 2393 2910 7.0E-53
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 2383 2910 1.0E-52
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 2384 2907 2.0E-52
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 2339 2910 7.0E-52
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 2383 2910 1.0E-51
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 2542 2907 4.0E-51
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 2393 2823 3.0E-50
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 2380 2910 2.0E-48
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 2348 2815 2.0E-47
sp|Q9VXG8|ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster GN=mei-41 PE=1 SV=2 2351 2910 2.0E-46
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 2365 2907 4.0E-44
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 2530 2910 2.0E-43
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 2517 2910 3.0E-43
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 2530 2907 3.0E-42
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 2553 2910 1.0E-41
sp|Q9N3Q4|ATM_CAEEL Serine/threonine-protein kinase ATM OS=Caenorhabditis elegans GN=atm-1 PE=3 SV=3 2418 2812 1.0E-41
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 2530 2907 1.0E-41
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 2530 2907 4.0E-41
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 2546 2910 1.0E-40
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 2553 2821 2.0E-40
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 2553 2821 2.0E-40
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 2516 2907 2.0E-39
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 2553 2910 2.0E-39
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 16 581 7.0E-38
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 2551 2835 1.0E-37
sp|Q8SSE7|ATR_ENCCU Probable serine/threonine-protein kinase MEC1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MEC1 PE=3 SV=2 2553 2910 1.0E-37
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 2562 2835 2.0E-37
sp|Q54UC0|PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=dnapkcs PE=3 SV=2 2526 2829 4.0E-33
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 2526 2910 4.0E-33
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 2553 2910 2.0E-32
sp|Q61CW2|SMG1_CAEBR Serine/threonine-protein kinase smg-1 OS=Caenorhabditis briggsae GN=smg-1 PE=3 SV=3 2517 2821 6.0E-31
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 2701 2823 1.0E-30
sp|O01510|SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans GN=smg-1 PE=1 SV=3 2539 2821 2.0E-30
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 2526 2910 2.0E-30
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 2560 2909 5.0E-30
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 2526 2910 4.0E-29
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 2526 2910 1.0E-28
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 2704 2820 3.0E-26
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 43 526 1.0E-24
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 2578 2813 3.0E-10
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 957 1211 8.0E-10
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 2578 2815 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0004674 protein serine/threonine kinase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004672 protein kinase activity No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2629
MSSPHMSTVRDLARDISTGSIKDRDKAIEDLTNLLRNNSVNLTALEDKSYHDILEAIFNVVLKDKSVYHGKKNSQ
SRRNSAASRLSKCATAVRLAVSRGVSKLKLKTLLAVIDHITQTLVGFDKEFVAPLFHDYVKALVAVLSRPAHVEL
LARKDAVVWRACVDFLIKVAEESLPEKPASLTCSTGPSPSSAGTTPRPTAPSQRRTSSHDGGPLRDSLVGLQYLV
EAANAPLGHKAKLVTDLAVKVLDLQNLSLGPLQTMSFAIANTTFAATEADDFNFACGLVRQLLPLMSHWWRADKA
SHDDLIRGLRNEISRSLFLMHLHVQHLAINCWDEGVRDHVENLSDTLWSEYSRRCQDFGLQLNDVTFYMTSLPSN
ALRLEIFGLHNHSAEGEGNWALLQNLGFLEAVMMRPRPTMGQVEDQDADGQSRKKPRLDNGGLSRFKLKLTLRNT
AVQRTALQLIPFLLANNALEIDNMVEILTELTTCASRKNADNVSWAFVACASLLSIRAIGDSQSDTWRQLWRLAS
RCLSLPSMSRAACLLLHAILKERVLPVHTLSGDINSFVTAADVHGPAVLCDTSMALMLLLFHERNARLPNASQTT
SSQIIRWAFLKWLPDEPSYATSHSMHVRPIQYVNLLRACCGLHPISSHNQDVIVGSTLSAAWKVQGDIAPFNKYL
LLIAGSRLEQDSNGRDSVPTTSALLNSDPSSFYASRNLVVELFHPKLQGLVAACSSWSKRPADGGSSISLEWFHS
ILSACIAGVMLVPLGSDVCPTQSSSMEQSLIDIAEKSIMAALNSVEPEVFVYTGLQLLRQCIPNITTHNLNLLYD
SNNALVRMLCRVSGCLEQTSTAPASNNGDSMHLDDEFVSQGSKAMAATVSTPIPRQNIQMAMSARAFTTETKTRL
CLLKALDQEKQQCSEIPDCWVRELLSMPDNEIFLCQGLLIELSRSDLAMTSDNLRLLVRRMGEIMGKPEYQCCEV
VLSTCIEILSGWHQIWLNDSDRLAEYAGDLYTHFIKINMPCNVFSPPARMAMVNLLLTLLRANPDYGEQLKLDSC
RTSLLYALKTSTVKVKCFIADRLASIFELYILELHEEVFVDVLECLPSDAEDKAGIVFRLLALSKMAMSWPTLLR
RCAYHIFEIPGKIPWSTQHAKWCLAQVSDSLGLESAQDLFRLFCRQILYTWMESNSIDTIPFSIFGFCDLEELLQ
STRGEAIAIALMRGQEQDSADIAEVLGLSETELILENFPVILSYCMIYSYASRASNRGEDRIKSKLGPKRYAEAL
HASFVDIVALFMGLVDNEDPNENALNRIPELDYAVQSMAAIKQIAHSKAKLPPDQQPKFRAKHVFPKLLELCKVT
EFELSQLWTPALVASVVRKLLGRIHPAMGSLNACSALRKVRLLVCLAGPTAFNSYCLEMLLNSLRVFMVDSECAD
DVIGVSEYLLGNGNPYLSDRPCFVAGYALSALASLRVFLESSQSSTTEEDQFKATMIKAQQFHAWLVKYLSTYNS
TRFVSVSQLESFQAIIETAGQIKSSGNADNGSPEGKLLLHILKDDESCQGLLNESSRKLALGLLCGDFNMPTVTN
DMIESDDKAICHAGAVWKSCQWPELSSNYLAWAGRVVGRSFAASGGIPDGILRESQLDEYQRIAQEPHGSEAALL
HLIEVVTSNQDSGVAGLAEAVLRLIVSQADMRQDQTLAATLQRSLSESLVAASNWDQFPLPPSEVPLNAVFQQPW
PQDIGSPDWKVQLSVYLAQSVPASVLLSVMPVLLSRVAGFAHKAFPFLVHMVLCSELDGQRVMRQNLSGAIKKWL
PTTGAAAQSNLRLLINTILYLRTQEFPNETSIEDRLRWLKIDFAEAASTATRCGMYKTALLFAEIAMSEGTPSAR
SSCLAEMKSTLLTIYENIDDPDTYYGLPEEASLTNVLARVEYEQEGSKSLAFRGAQYDENIRLRSADAQGDAQAL
VVALGTLGHSGISHSVLQNQQNLDGSVACLESTFGTARRLEIWDLPAPCKWEHHSVSLYKAYQALHQATELPPVR
STIHDGLGRIMQDLAGSNDNATKVRGRLAALASLTELEDGVHVGDEDAMEVLLSKFKLRDGWMRSGRYDDVSQIL
SCRETMTSMLSQHPALVSSPRFTVKNLRQLQVETMLMASTMYRHHGALQESLAISTALNKLIAVCQSLELHVDAA
IDIDIANSLWDHGEMSTSIRMLQKIDKDSCLEEQSIPVSRCVLLSKIGDKISIARLEKPRDIQKTYLEPALKELR
RQENRSKEAGAVYHQFAMFCDGQLQDTNGQEDLKRLHSLRQAKSDEVAALKALIASTTDKQNKLRYSHALAKEKQ
WLDLDEQELKRVEQTRSEFVRLSLENYLLSMQASDDYKNDALRFTALWLERWAEEATNKAVSRHLPCVPTAKFAG
LMNQLSSRLQNEQGMFQKVLMDLVYSICRDHPYHGMYQIWSGIKAKAQETDQAAVLRVQATEKVAQRLQSTQALA
KIWLAIDKTSRQYHAFAMDKSSKYKMGAKLGLKETPAGAGLMSCLDKFRIPPPTMHIAVSAAKDYSQVPVMCRLE
PCMSIASGVSAPKIITAIGSDGLKYKQLVKGGHDDLRQDAIMEQVFAAVSSLLQLHKSTQQRSLGIRTYKVLPLT
ATSGLIEFVADTTPLHEFLMPAHERYFPRDIKSSECRKDIFAVQSKTFEVRMDTYRKVTQRFHPVMRFFFMEHFV
NPDEWFARQRAYTRSTAAVSMLGHVLGLGDRHCHNILLDTKTGEVVHIDLGVAFEAGRILPVPELVPFRLTRDIV
DGMGITKTEGVFRRCCEFTLHALREEQYSIMTILDVLRYDPLYTWTVSPLRLAKLNKARQSDSDVGAAPDDAEPR
VKDTRSKGKCNEPSEADRALEVVRKKLSKTLSVTATVNDLIHQASDERNLAVLYSGWAAWA*
Coding >OphauB2|2629
ATGTCGTCGCCGCACATGTCAACCGTAAGAGACCTTGCCAGAGACATATCCACCGGCTCCATCAAAGACCGGGAT
AAGGCCATAGAGGATTTAACAAACCTCCTTCGAAACAACTCTGTCAACCTCACCGCTCTAGAAGATAAAAGCTAT
CATGATATCCTAGAAGCAATCTTCAACGTAGTTCTGAAGGACAAGTCAGTCTACCATGGAAAGAAGAACTCGCAG
TCTCGACGCAACAGTGCCGCCTCGCGCTTATCTAAATGCGCTACGGCTGTCAGGCTGGCTGTTTCTCGAGGCGTC
TCCAAACTAAAGCTCAAAACACTGCTTGCCGTGATAGACCACATCACGCAAACTCTTGTCGGTTTTGACAAAGAG
TTCGTGGCGCCTCTATTCCATGACTATGTCAAGGCCCTGGTAGCGGTGCTTTCGCGCCCAGCCCATGTCGAGCTC
TTGGCCAGAAAGGATGCCGTCGTTTGGCGGGCGTGCGTCGACTTTCTCATCAAAGTAGCCGAGGAGAGTCTTCCT
GAAAAGCCAGCCTCTTTAACTTGTTCGACAGGACCATCTCCTAGTTCGGCTGGGACAACACCAAGGCCGACAGCC
CCTAGCCAGCGACGCACCAGCAGCCATGATGGAGGCCCTTTGCGTGACTCCCTTGTCGGTCTCCAATATTTGGTA
GAGGCAGCAAATGCTCCGCTTGGGCACAAGGCCAAGCTTGTTACAGACTTGGCAGTCAAGGTCCTTGACCTACAA
AATCTTAGTCTGGGGCCGCTTCAAACCATGTCATTTGCTATTGCAAACACTACATTTGCTGCTACTGAAGCTGAC
GACTTCAACTTTGCTTGTGGTCTCGTTAGGCAGCTGTTGCCCTTGATGAGTCATTGGTGGCGAGCCGACAAGGCC
TCTCACGATGACCTCATTAGAGGCTTGAGGAACGAAATCTCCCGCAGTCTTTTCTTGATGCATTTGCATGTTCAA
CACTTGGCCATCAACTGCTGGGACGAAGGTGTGCGAGACCATGTCGAAAATCTAAGCGATACTTTATGGTCCGAG
TACTCTAGAAGATGTCAGGACTTTGGGCTACAGCTCAATGACGTTACCTTCTACATGACTTCCTTGCCTTCGAAT
GCTTTGCGCCTCGAAATCTTTGGTCTACACAACCATAGTGCTGAGGGAGAAGGCAACTGGGCTTTGCTTCAGAAT
CTTGGCTTTTTAGAAGCAGTCATGATGCGTCCCAGACCTACAATGGGCCAAGTTGAGGACCAGGATGCAGACGGG
CAATCTCGCAAGAAGCCCCGCCTCGATAACGGAGGCTTGAGCCGCTTCAAGCTGAAATTGACGCTGAGAAATACA
GCAGTTCAGAGGACGGCTCTTCAGCTCATTCCCTTTCTCCTTGCCAACAATGCGCTGGAAATTGACAATATGGTG
GAAATACTCACCGAGCTCACCACTTGTGCCTCGCGTAAGAACGCAGACAACGTGAGCTGGGCATTTGTTGCCTGC
GCGAGTTTACTTTCGATTCGCGCCATTGGTGACAGCCAGAGCGATACTTGGAGGCAGCTCTGGCGCTTGGCATCT
CGATGCCTCAGCCTCCCGTCCATGAGCCGTGCTGCCTGTCTCCTGCTGCATGCCATACTCAAGGAACGTGTTCTC
CCTGTGCACACGCTCTCAGGAGATATCAATAGCTTTGTCACGGCTGCAGATGTTCATGGCCCTGCTGTGCTATGC
GACACTTCAATGGCCTTGATGCTTCTTCTGTTCCATGAACGCAATGCGAGATTGCCAAATGCGAGCCAGACCACC
AGCAGCCAAATCATCAGATGGGCATTTTTGAAGTGGCTCCCTGACGAGCCGAGCTATGCCACTTCTCACTCCATG
CACGTACGGCCAATTCAGTATGTGAACCTGTTGCGGGCCTGTTGCGGGCTGCATCCGATTTCGAGCCACAACCAG
GATGTTATTGTCGGCTCGACTCTCAGCGCTGCCTGGAAGGTCCAGGGTGACATTGCACCCTTCAATAAGTATCTT
CTCCTTATTGCAGGCAGTCGACTGGAGCAAGACTCCAACGGCCGAGATTCAGTTCCCACGACGAGTGCCCTTCTC
AATTCCGACCCCAGCAGCTTTTATGCATCGAGAAATTTGGTTGTCGAGCTCTTCCATCCCAAGCTCCAGGGACTC
GTGGCGGCATGTAGCTCGTGGAGCAAAAGACCAGCCGACGGCGGCAGCTCCATTTCACTAGAGTGGTTTCATAGT
ATCCTTTCTGCATGTATAGCTGGCGTCATGCTTGTGCCGCTAGGCAGTGATGTCTGTCCGACACAATCGAGCTCA
ATGGAACAGAGCTTGATTGATATCGCCGAGAAGAGCATCATGGCTGCCCTCAACTCGGTCGAGCCCGAAGTCTTT
GTCTATACAGGTCTACAGCTGTTGCGCCAGTGCATCCCAAATATCACCACGCACAATCTCAACCTGTTATACGAC
AGCAATAATGCTCTTGTCCGGATGCTGTGCAGAGTCTCCGGCTGCCTTGAGCAGACAAGCACGGCGCCGGCATCC
AATAACGGCGATTCTATGCATCTTGATGACGAGTTTGTTTCACAAGGCAGCAAAGCCATGGCAGCCACAGTTTCT
ACTCCGATCCCGAGACAGAATATTCAAATGGCCATGAGTGCTCGGGCGTTCACCACCGAGACAAAAACACGCCTA
TGCTTGTTAAAAGCACTTGATCAAGAAAAGCAACAGTGCAGTGAGATCCCGGACTGCTGGGTCAGAGAGCTCTTG
TCAATGCCAGACAATGAGATTTTTCTCTGTCAAGGCCTGCTCATTGAGCTTTCTCGATCGGATCTGGCCATGACC
TCAGACAATTTGCGACTATTGGTTAGGAGAATGGGCGAAATTATGGGCAAGCCGGAGTACCAATGTTGTGAAGTT
GTCTTGTCGACATGCATCGAGATTCTGTCTGGCTGGCATCAGATTTGGCTTAATGACAGCGATAGGCTCGCCGAA
TACGCGGGTGATCTTTATACCCATTTTATCAAGATCAACATGCCTTGCAACGTGTTCTCACCCCCAGCGCGAATG
GCAATGGTCAATCTTCTGTTGACGCTTCTCAGGGCCAACCCAGACTATGGAGAGCAACTCAAACTTGACTCTTGT
CGAACGTCACTTTTATATGCCCTCAAAACGAGTACTGTCAAGGTCAAGTGTTTCATCGCCGATCGTCTTGCCAGC
ATCTTTGAGCTGTACATCCTTGAGCTACACGAAGAAGTTTTTGTCGATGTTCTGGAATGTCTACCTTCAGATGCA
GAAGACAAGGCTGGTATCGTCTTCAGGCTGTTGGCTCTGTCCAAGATGGCAATGTCGTGGCCCACATTGCTAAGG
AGATGCGCTTATCACATCTTTGAGATTCCAGGCAAGATTCCATGGTCAACACAGCATGCCAAGTGGTGTCTGGCC
CAAGTCTCGGACAGCTTGGGACTCGAATCTGCACAGGACCTGTTCCGCCTCTTTTGCCGTCAGATTCTCTACACA
TGGATGGAATCAAACTCGATCGACACCATTCCCTTCTCCATCTTTGGTTTCTGCGACTTGGAAGAGTTGCTCCAG
TCGACTCGGGGCGAAGCAATTGCCATCGCTTTGATGAGAGGCCAAGAGCAAGACAGCGCAGACATAGCAGAGGTC
CTGGGGCTGAGTGAGACGGAGCTCATATTGGAAAATTTTCCAGTGATTTTGTCCTATTGCATGATATACTCATAT
GCTTCGAGAGCTTCGAACCGAGGTGAAGACCGGATCAAGAGCAAGTTGGGGCCCAAAAGGTACGCTGAAGCTCTC
CATGCCAGCTTTGTCGATATTGTGGCGCTTTTCATGGGCCTTGTGGACAATGAGGATCCCAATGAGAACGCCTTG
AACAGGATCCCCGAGCTGGATTATGCTGTGCAAAGCATGGCGGCTATTAAGCAAATTGCACACTCGAAAGCAAAG
CTTCCTCCAGATCAGCAGCCCAAGTTTCGAGCAAAGCACGTTTTTCCCAAGCTGCTCGAGCTGTGTAAGGTTACA
GAATTCGAGCTCAGCCAGCTCTGGACTCCAGCTCTTGTAGCTTCGGTTGTCCGAAAGCTCCTTGGCCGCATACAC
CCTGCCATGGGATCCCTAAATGCTTGTTCTGCTCTTCGAAAGGTTCGCCTTCTGGTGTGTCTGGCAGGACCAACG
GCCTTCAACTCTTACTGCCTGGAAATGCTTTTGAACTCTTTGCGCGTCTTCATGGTCGACTCGGAATGTGCCGAT
GATGTTATAGGCGTCAGTGAGTATCTGCTTGGAAACGGCAACCCCTATCTCAGCGACAGACCGTGCTTCGTGGCA
GGCTACGCTCTGTCAGCTCTGGCCTCTCTTCGAGTTTTTCTCGAATCGAGCCAGTCGAGTACGACAGAAGAAGAC
CAGTTCAAAGCCACAATGATCAAGGCTCAACAATTTCATGCATGGCTAGTCAAATATTTATCCACATACAACTCG
ACGCGGTTCGTTAGCGTGTCCCAGCTTGAATCGTTTCAGGCCATTATTGAGACAGCAGGGCAGATCAAATCCTCG
GGAAATGCAGACAATGGTTCTCCCGAGGGCAAGCTGCTCCTCCACATCTTGAAAGACGACGAATCATGCCAGGGC
CTCTTGAATGAATCCTCTCGCAAGCTTGCCTTAGGGCTACTTTGTGGCGATTTCAACATGCCCACTGTCACTAAT
GACATGATTGAAAGCGACGACAAAGCCATCTGCCATGCCGGCGCCGTGTGGAAGAGCTGCCAGTGGCCTGAACTC
AGCTCCAACTATCTTGCCTGGGCCGGACGGGTAGTGGGGAGATCATTCGCAGCATCGGGAGGAATCCCAGACGGC
ATCCTACGCGAGTCACAGCTGGATGAATATCAGAGGATAGCACAGGAGCCCCATGGGTCTGAAGCAGCACTACTG
CACTTGATTGAAGTAGTCACGTCGAACCAAGACTCTGGCGTTGCAGGTCTTGCCGAGGCTGTCCTAAGGCTTATA
GTATCCCAAGCAGATATGCGCCAGGACCAGACTCTTGCCGCAACACTTCAGAGAAGCCTATCCGAGTCTCTAGTT
GCCGCCTCGAATTGGGACCAGTTTCCGTTGCCTCCATCAGAGGTGCCTCTTAATGCCGTCTTCCAGCAGCCATGG
CCACAAGACATTGGGTCCCCGGATTGGAAGGTTCAGCTCAGTGTCTATCTGGCGCAGTCTGTGCCTGCATCTGTC
TTGCTATCGGTGATGCCAGTGCTGCTCTCTCGTGTCGCAGGCTTCGCCCACAAGGCGTTTCCGTTTCTTGTCCAC
ATGGTGCTCTGCTCAGAGCTAGATGGACAACGGGTCATGCGGCAGAATCTGTCAGGAGCCATCAAGAAGTGGTTG
CCTACGACAGGTGCTGCTGCTCAAAGCAACCTGAGGCTTTTAATCAACACGATACTCTATCTCAGGACTCAAGAG
TTCCCCAACGAGACTTCTATCGAGGATCGACTCCGCTGGCTGAAAATCGACTTTGCTGAAGCAGCTTCAACAGCA
ACGCGCTGCGGCATGTACAAGACGGCACTTCTCTTTGCCGAGATTGCAATGTCCGAAGGCACGCCCTCGGCTCGG
TCCTCTTGTCTGGCGGAAATGAAGAGCACATTGTTGACTATATACGAAAATATTGACGACCCCGACACCTACTAC
GGCCTCCCTGAAGAGGCTAGCCTGACCAATGTACTAGCCCGCGTCGAGTATGAGCAAGAAGGATCCAAGAGCTTG
GCATTCCGTGGAGCGCAGTACGATGAAAATATTCGTCTACGGAGTGCGGACGCCCAAGGAGATGCCCAGGCGCTC
GTTGTAGCACTCGGGACTTTGGGACACTCAGGAATCTCGCATTCAGTACTCCAAAATCAGCAAAATCTCGATGGC
TCGGTAGCGTGTCTGGAAAGCACGTTTGGCACAGCAAGACGACTAGAGATTTGGGACCTGCCGGCGCCATGCAAG
TGGGAGCATCATAGCGTATCCCTGTATAAAGCATACCAGGCACTTCATCAGGCCACTGAGCTGCCGCCAGTACGC
TCAACGATTCATGATGGGCTGGGGCGCATAATGCAGGATTTGGCTGGCTCTAATGACAATGCCACCAAGGTGCGA
GGTCGACTGGCAGCGCTGGCATCACTAACAGAGCTTGAGGATGGTGTGCACGTTGGTGATGAAGATGCAATGGAG
GTGTTGCTGTCAAAGTTCAAATTGCGAGACGGCTGGATGAGGAGCGGGAGATACGACGACGTGAGCCAGATACTG
TCTTGCCGGGAGACTATGACAAGCATGCTGAGCCAACACCCAGCGCTTGTGAGTAGCCCTCGGTTCACAGTCAAG
AATCTGAGGCAGCTGCAGGTGGAGACGATGCTCATGGCATCCACCATGTACCGCCATCACGGCGCCTTGCAGGAG
TCGCTGGCCATTTCGACGGCGCTCAACAAGCTGATAGCCGTGTGCCAAAGCTTGGAGCTCCATGTGGACGCTGCC
ATTGATATCGACATTGCCAACTCACTGTGGGACCATGGAGAGATGAGCACGTCAATACGCATGCTTCAGAAGATC
GACAAGGACTCATGTCTGGAGGAGCAGAGTATTCCCGTCAGCCGCTGCGTCTTGCTGTCCAAGATTGGTGACAAG
ATATCGATTGCGCGACTGGAGAAGCCCAGGGACATACAAAAGACTTATCTAGAGCCTGCGCTTAAAGAGCTTCGG
CGACAGGAAAACCGCAGCAAGGAGGCCGGGGCCGTGTACCATCAGTTTGCCATGTTTTGCGACGGGCAGCTGCAG
GACACGAATGGGCAAGAGGACTTGAAGAGACTGCACAGTCTGCGGCAGGCAAAGAGCGACGAAGTGGCAGCACTC
AAAGCGCTGATTGCTTCCACGACAGACAAACAGAACAAGTTGCGCTACTCGCATGCGTTGGCCAAGGAGAAGCAG
TGGCTGGATCTGGACGAGCAGGAGCTGAAGCGCGTGGAGCAGACACGAAGCGAGTTTGTACGGCTGAGCCTGGAA
AACTACCTCTTGTCGATGCAAGCGTCGGACGACTACAAGAATGACGCGCTGCGCTTCACGGCGCTGTGGCTGGAG
AGATGGGCAGAAGAGGCGACCAATAAGGCTGTCTCGCGCCATCTGCCGTGTGTGCCGACGGCCAAGTTTGCCGGG
CTGATGAACCAGCTGTCGTCGCGGCTGCAGAACGAGCAGGGCATGTTCCAAAAGGTGCTCATGGATCTGGTGTAC
AGCATCTGTCGCGACCACCCCTACCACGGCATGTACCAAATCTGGTCGGGCATCAAGGCCAAAGCGCAGGAGACG
GACCAGGCGGCTGTGCTGCGCGTACAGGCGACTGAAAAGGTTGCGCAGCGGCTGCAAAGCACGCAGGCCCTGGCC
AAGATTTGGCTGGCGATTGACAAGACGAGCCGACAGTACCATGCCTTTGCCATGGACAAGAGCTCCAAGTATAAG
ATGGGGGCCAAGCTGGGGCTCAAGGAGACGCCGGCGGGCGCGGGCCTCATGAGCTGCTTGGACAAGTTTCGCATT
CCACCGCCCACGATGCACATAGCAGTGTCGGCGGCCAAGGACTACTCGCAGGTGCCCGTCATGTGCCGCCTCGAG
CCATGCATGAGCATCGCTTCTGGCGTCAGCGCGCCCAAGATCATCACGGCCATTGGCAGCGACGGACTCAAGTAC
AAGCAGCTGGTCAAGGGCGGGCACGATGACCTGCGCCAGGACGCCATCATGGAGCAAGTCTTTGCCGCCGTGTCG
TCTCTGCTCCAGCTGCACAAGAGCACGCAGCAGCGCAGCCTGGGCATCCGGACCTACAAGGTGCTGCCCCTGACA
GCTACGTCGGGCCTCATCGAGTTTGTGGCCGACACGACGCCTCTGCACGAGTTTCTCATGCCTGCTCACGAGAGA
TACTTCCCGCGCGACATCAAATCGTCTGAGTGTAGAAAGGACATCTTTGCCGTCCAGAGCAAGACGTTTGAGGTG
CGCATGGACACGTATCGCAAGGTGACGCAGCGCTTCCACCCCGTCATGCGCTTCTTCTTCATGGAGCACTTTGTC
AACCCCGACGAGTGGTTTGCCAGGCAGCGGGCTTACACGAGGAGCACTGCCGCCGTGTCCATGCTGGGCCATGTG
CTGGGCCTGGGCGACCGCCACTGCCACAACATACTGCTCGACACCAAGACGGGCGAGGTGGTGCACATTGACCTG
GGCGTGGCCTTTGAGGCGGGGCGCATTCTGCCCGTGCCGGAGCTGGTGCCCTTTCGCCTGACGCGAGACATTGTT
GACGGCATGGGAATCACAAAGACCGAGGGTGTCTTTCGCCGCTGCTGCGAGTTTACCCTGCATGCCCTACGCGAG
GAGCAGTATTCCATCATGACCATTCTCGACGTCTTGCGCTACGATCCCCTTTACACGTGGACCGTTTCGCCCCTG
CGGCTAGCCAAGCTGAACAAGGCAAGGCAGAGCGACAGCGATGTCGGAGCTGCGCCGGATGATGCAGAGCCAAGA
GTCAAGGACACGAGGTCCAAGGGCAAGTGCAACGAGCCCTCTGAGGCTGATCGCGCACTCGAGGTGGTGCGCAAA
AAGCTGTCCAAGACGTTGAGCGTTACCGCCACCGTGAATGACTTGATTCATCAAGCCTCAGACGAACGGAACCTT
GCCGTTTTGTATTCTGGTTGGGCAGCGTGGGCTTGA
Transcript >OphauB2|2629
ATGTCGTCGCCGCACATGTCAACCGTAAGAGACCTTGCCAGAGACATATCCACCGGCTCCATCAAAGACCGGGAT
AAGGCCATAGAGGATTTAACAAACCTCCTTCGAAACAACTCTGTCAACCTCACCGCTCTAGAAGATAAAAGCTAT
CATGATATCCTAGAAGCAATCTTCAACGTAGTTCTGAAGGACAAGTCAGTCTACCATGGAAAGAAGAACTCGCAG
TCTCGACGCAACAGTGCCGCCTCGCGCTTATCTAAATGCGCTACGGCTGTCAGGCTGGCTGTTTCTCGAGGCGTC
TCCAAACTAAAGCTCAAAACACTGCTTGCCGTGATAGACCACATCACGCAAACTCTTGTCGGTTTTGACAAAGAG
TTCGTGGCGCCTCTATTCCATGACTATGTCAAGGCCCTGGTAGCGGTGCTTTCGCGCCCAGCCCATGTCGAGCTC
TTGGCCAGAAAGGATGCCGTCGTTTGGCGGGCGTGCGTCGACTTTCTCATCAAAGTAGCCGAGGAGAGTCTTCCT
GAAAAGCCAGCCTCTTTAACTTGTTCGACAGGACCATCTCCTAGTTCGGCTGGGACAACACCAAGGCCGACAGCC
CCTAGCCAGCGACGCACCAGCAGCCATGATGGAGGCCCTTTGCGTGACTCCCTTGTCGGTCTCCAATATTTGGTA
GAGGCAGCAAATGCTCCGCTTGGGCACAAGGCCAAGCTTGTTACAGACTTGGCAGTCAAGGTCCTTGACCTACAA
AATCTTAGTCTGGGGCCGCTTCAAACCATGTCATTTGCTATTGCAAACACTACATTTGCTGCTACTGAAGCTGAC
GACTTCAACTTTGCTTGTGGTCTCGTTAGGCAGCTGTTGCCCTTGATGAGTCATTGGTGGCGAGCCGACAAGGCC
TCTCACGATGACCTCATTAGAGGCTTGAGGAACGAAATCTCCCGCAGTCTTTTCTTGATGCATTTGCATGTTCAA
CACTTGGCCATCAACTGCTGGGACGAAGGTGTGCGAGACCATGTCGAAAATCTAAGCGATACTTTATGGTCCGAG
TACTCTAGAAGATGTCAGGACTTTGGGCTACAGCTCAATGACGTTACCTTCTACATGACTTCCTTGCCTTCGAAT
GCTTTGCGCCTCGAAATCTTTGGTCTACACAACCATAGTGCTGAGGGAGAAGGCAACTGGGCTTTGCTTCAGAAT
CTTGGCTTTTTAGAAGCAGTCATGATGCGTCCCAGACCTACAATGGGCCAAGTTGAGGACCAGGATGCAGACGGG
CAATCTCGCAAGAAGCCCCGCCTCGATAACGGAGGCTTGAGCCGCTTCAAGCTGAAATTGACGCTGAGAAATACA
GCAGTTCAGAGGACGGCTCTTCAGCTCATTCCCTTTCTCCTTGCCAACAATGCGCTGGAAATTGACAATATGGTG
GAAATACTCACCGAGCTCACCACTTGTGCCTCGCGTAAGAACGCAGACAACGTGAGCTGGGCATTTGTTGCCTGC
GCGAGTTTACTTTCGATTCGCGCCATTGGTGACAGCCAGAGCGATACTTGGAGGCAGCTCTGGCGCTTGGCATCT
CGATGCCTCAGCCTCCCGTCCATGAGCCGTGCTGCCTGTCTCCTGCTGCATGCCATACTCAAGGAACGTGTTCTC
CCTGTGCACACGCTCTCAGGAGATATCAATAGCTTTGTCACGGCTGCAGATGTTCATGGCCCTGCTGTGCTATGC
GACACTTCAATGGCCTTGATGCTTCTTCTGTTCCATGAACGCAATGCGAGATTGCCAAATGCGAGCCAGACCACC
AGCAGCCAAATCATCAGATGGGCATTTTTGAAGTGGCTCCCTGACGAGCCGAGCTATGCCACTTCTCACTCCATG
CACGTACGGCCAATTCAGTATGTGAACCTGTTGCGGGCCTGTTGCGGGCTGCATCCGATTTCGAGCCACAACCAG
GATGTTATTGTCGGCTCGACTCTCAGCGCTGCCTGGAAGGTCCAGGGTGACATTGCACCCTTCAATAAGTATCTT
CTCCTTATTGCAGGCAGTCGACTGGAGCAAGACTCCAACGGCCGAGATTCAGTTCCCACGACGAGTGCCCTTCTC
AATTCCGACCCCAGCAGCTTTTATGCATCGAGAAATTTGGTTGTCGAGCTCTTCCATCCCAAGCTCCAGGGACTC
GTGGCGGCATGTAGCTCGTGGAGCAAAAGACCAGCCGACGGCGGCAGCTCCATTTCACTAGAGTGGTTTCATAGT
ATCCTTTCTGCATGTATAGCTGGCGTCATGCTTGTGCCGCTAGGCAGTGATGTCTGTCCGACACAATCGAGCTCA
ATGGAACAGAGCTTGATTGATATCGCCGAGAAGAGCATCATGGCTGCCCTCAACTCGGTCGAGCCCGAAGTCTTT
GTCTATACAGGTCTACAGCTGTTGCGCCAGTGCATCCCAAATATCACCACGCACAATCTCAACCTGTTATACGAC
AGCAATAATGCTCTTGTCCGGATGCTGTGCAGAGTCTCCGGCTGCCTTGAGCAGACAAGCACGGCGCCGGCATCC
AATAACGGCGATTCTATGCATCTTGATGACGAGTTTGTTTCACAAGGCAGCAAAGCCATGGCAGCCACAGTTTCT
ACTCCGATCCCGAGACAGAATATTCAAATGGCCATGAGTGCTCGGGCGTTCACCACCGAGACAAAAACACGCCTA
TGCTTGTTAAAAGCACTTGATCAAGAAAAGCAACAGTGCAGTGAGATCCCGGACTGCTGGGTCAGAGAGCTCTTG
TCAATGCCAGACAATGAGATTTTTCTCTGTCAAGGCCTGCTCATTGAGCTTTCTCGATCGGATCTGGCCATGACC
TCAGACAATTTGCGACTATTGGTTAGGAGAATGGGCGAAATTATGGGCAAGCCGGAGTACCAATGTTGTGAAGTT
GTCTTGTCGACATGCATCGAGATTCTGTCTGGCTGGCATCAGATTTGGCTTAATGACAGCGATAGGCTCGCCGAA
TACGCGGGTGATCTTTATACCCATTTTATCAAGATCAACATGCCTTGCAACGTGTTCTCACCCCCAGCGCGAATG
GCAATGGTCAATCTTCTGTTGACGCTTCTCAGGGCCAACCCAGACTATGGAGAGCAACTCAAACTTGACTCTTGT
CGAACGTCACTTTTATATGCCCTCAAAACGAGTACTGTCAAGGTCAAGTGTTTCATCGCCGATCGTCTTGCCAGC
ATCTTTGAGCTGTACATCCTTGAGCTACACGAAGAAGTTTTTGTCGATGTTCTGGAATGTCTACCTTCAGATGCA
GAAGACAAGGCTGGTATCGTCTTCAGGCTGTTGGCTCTGTCCAAGATGGCAATGTCGTGGCCCACATTGCTAAGG
AGATGCGCTTATCACATCTTTGAGATTCCAGGCAAGATTCCATGGTCAACACAGCATGCCAAGTGGTGTCTGGCC
CAAGTCTCGGACAGCTTGGGACTCGAATCTGCACAGGACCTGTTCCGCCTCTTTTGCCGTCAGATTCTCTACACA
TGGATGGAATCAAACTCGATCGACACCATTCCCTTCTCCATCTTTGGTTTCTGCGACTTGGAAGAGTTGCTCCAG
TCGACTCGGGGCGAAGCAATTGCCATCGCTTTGATGAGAGGCCAAGAGCAAGACAGCGCAGACATAGCAGAGGTC
CTGGGGCTGAGTGAGACGGAGCTCATATTGGAAAATTTTCCAGTGATTTTGTCCTATTGCATGATATACTCATAT
GCTTCGAGAGCTTCGAACCGAGGTGAAGACCGGATCAAGAGCAAGTTGGGGCCCAAAAGGTACGCTGAAGCTCTC
CATGCCAGCTTTGTCGATATTGTGGCGCTTTTCATGGGCCTTGTGGACAATGAGGATCCCAATGAGAACGCCTTG
AACAGGATCCCCGAGCTGGATTATGCTGTGCAAAGCATGGCGGCTATTAAGCAAATTGCACACTCGAAAGCAAAG
CTTCCTCCAGATCAGCAGCCCAAGTTTCGAGCAAAGCACGTTTTTCCCAAGCTGCTCGAGCTGTGTAAGGTTACA
GAATTCGAGCTCAGCCAGCTCTGGACTCCAGCTCTTGTAGCTTCGGTTGTCCGAAAGCTCCTTGGCCGCATACAC
CCTGCCATGGGATCCCTAAATGCTTGTTCTGCTCTTCGAAAGGTTCGCCTTCTGGTGTGTCTGGCAGGACCAACG
GCCTTCAACTCTTACTGCCTGGAAATGCTTTTGAACTCTTTGCGCGTCTTCATGGTCGACTCGGAATGTGCCGAT
GATGTTATAGGCGTCAGTGAGTATCTGCTTGGAAACGGCAACCCCTATCTCAGCGACAGACCGTGCTTCGTGGCA
GGCTACGCTCTGTCAGCTCTGGCCTCTCTTCGAGTTTTTCTCGAATCGAGCCAGTCGAGTACGACAGAAGAAGAC
CAGTTCAAAGCCACAATGATCAAGGCTCAACAATTTCATGCATGGCTAGTCAAATATTTATCCACATACAACTCG
ACGCGGTTCGTTAGCGTGTCCCAGCTTGAATCGTTTCAGGCCATTATTGAGACAGCAGGGCAGATCAAATCCTCG
GGAAATGCAGACAATGGTTCTCCCGAGGGCAAGCTGCTCCTCCACATCTTGAAAGACGACGAATCATGCCAGGGC
CTCTTGAATGAATCCTCTCGCAAGCTTGCCTTAGGGCTACTTTGTGGCGATTTCAACATGCCCACTGTCACTAAT
GACATGATTGAAAGCGACGACAAAGCCATCTGCCATGCCGGCGCCGTGTGGAAGAGCTGCCAGTGGCCTGAACTC
AGCTCCAACTATCTTGCCTGGGCCGGACGGGTAGTGGGGAGATCATTCGCAGCATCGGGAGGAATCCCAGACGGC
ATCCTACGCGAGTCACAGCTGGATGAATATCAGAGGATAGCACAGGAGCCCCATGGGTCTGAAGCAGCACTACTG
CACTTGATTGAAGTAGTCACGTCGAACCAAGACTCTGGCGTTGCAGGTCTTGCCGAGGCTGTCCTAAGGCTTATA
GTATCCCAAGCAGATATGCGCCAGGACCAGACTCTTGCCGCAACACTTCAGAGAAGCCTATCCGAGTCTCTAGTT
GCCGCCTCGAATTGGGACCAGTTTCCGTTGCCTCCATCAGAGGTGCCTCTTAATGCCGTCTTCCAGCAGCCATGG
CCACAAGACATTGGGTCCCCGGATTGGAAGGTTCAGCTCAGTGTCTATCTGGCGCAGTCTGTGCCTGCATCTGTC
TTGCTATCGGTGATGCCAGTGCTGCTCTCTCGTGTCGCAGGCTTCGCCCACAAGGCGTTTCCGTTTCTTGTCCAC
ATGGTGCTCTGCTCAGAGCTAGATGGACAACGGGTCATGCGGCAGAATCTGTCAGGAGCCATCAAGAAGTGGTTG
CCTACGACAGGTGCTGCTGCTCAAAGCAACCTGAGGCTTTTAATCAACACGATACTCTATCTCAGGACTCAAGAG
TTCCCCAACGAGACTTCTATCGAGGATCGACTCCGCTGGCTGAAAATCGACTTTGCTGAAGCAGCTTCAACAGCA
ACGCGCTGCGGCATGTACAAGACGGCACTTCTCTTTGCCGAGATTGCAATGTCCGAAGGCACGCCCTCGGCTCGG
TCCTCTTGTCTGGCGGAAATGAAGAGCACATTGTTGACTATATACGAAAATATTGACGACCCCGACACCTACTAC
GGCCTCCCTGAAGAGGCTAGCCTGACCAATGTACTAGCCCGCGTCGAGTATGAGCAAGAAGGATCCAAGAGCTTG
GCATTCCGTGGAGCGCAGTACGATGAAAATATTCGTCTACGGAGTGCGGACGCCCAAGGAGATGCCCAGGCGCTC
GTTGTAGCACTCGGGACTTTGGGACACTCAGGAATCTCGCATTCAGTACTCCAAAATCAGCAAAATCTCGATGGC
TCGGTAGCGTGTCTGGAAAGCACGTTTGGCACAGCAAGACGACTAGAGATTTGGGACCTGCCGGCGCCATGCAAG
TGGGAGCATCATAGCGTATCCCTGTATAAAGCATACCAGGCACTTCATCAGGCCACTGAGCTGCCGCCAGTACGC
TCAACGATTCATGATGGGCTGGGGCGCATAATGCAGGATTTGGCTGGCTCTAATGACAATGCCACCAAGGTGCGA
GGTCGACTGGCAGCGCTGGCATCACTAACAGAGCTTGAGGATGGTGTGCACGTTGGTGATGAAGATGCAATGGAG
GTGTTGCTGTCAAAGTTCAAATTGCGAGACGGCTGGATGAGGAGCGGGAGATACGACGACGTGAGCCAGATACTG
TCTTGCCGGGAGACTATGACAAGCATGCTGAGCCAACACCCAGCGCTTGTGAGTAGCCCTCGGTTCACAGTCAAG
AATCTGAGGCAGCTGCAGGTGGAGACGATGCTCATGGCATCCACCATGTACCGCCATCACGGCGCCTTGCAGGAG
TCGCTGGCCATTTCGACGGCGCTCAACAAGCTGATAGCCGTGTGCCAAAGCTTGGAGCTCCATGTGGACGCTGCC
ATTGATATCGACATTGCCAACTCACTGTGGGACCATGGAGAGATGAGCACGTCAATACGCATGCTTCAGAAGATC
GACAAGGACTCATGTCTGGAGGAGCAGAGTATTCCCGTCAGCCGCTGCGTCTTGCTGTCCAAGATTGGTGACAAG
ATATCGATTGCGCGACTGGAGAAGCCCAGGGACATACAAAAGACTTATCTAGAGCCTGCGCTTAAAGAGCTTCGG
CGACAGGAAAACCGCAGCAAGGAGGCCGGGGCCGTGTACCATCAGTTTGCCATGTTTTGCGACGGGCAGCTGCAG
GACACGAATGGGCAAGAGGACTTGAAGAGACTGCACAGTCTGCGGCAGGCAAAGAGCGACGAAGTGGCAGCACTC
AAAGCGCTGATTGCTTCCACGACAGACAAACAGAACAAGTTGCGCTACTCGCATGCGTTGGCCAAGGAGAAGCAG
TGGCTGGATCTGGACGAGCAGGAGCTGAAGCGCGTGGAGCAGACACGAAGCGAGTTTGTACGGCTGAGCCTGGAA
AACTACCTCTTGTCGATGCAAGCGTCGGACGACTACAAGAATGACGCGCTGCGCTTCACGGCGCTGTGGCTGGAG
AGATGGGCAGAAGAGGCGACCAATAAGGCTGTCTCGCGCCATCTGCCGTGTGTGCCGACGGCCAAGTTTGCCGGG
CTGATGAACCAGCTGTCGTCGCGGCTGCAGAACGAGCAGGGCATGTTCCAAAAGGTGCTCATGGATCTGGTGTAC
AGCATCTGTCGCGACCACCCCTACCACGGCATGTACCAAATCTGGTCGGGCATCAAGGCCAAAGCGCAGGAGACG
GACCAGGCGGCTGTGCTGCGCGTACAGGCGACTGAAAAGGTTGCGCAGCGGCTGCAAAGCACGCAGGCCCTGGCC
AAGATTTGGCTGGCGATTGACAAGACGAGCCGACAGTACCATGCCTTTGCCATGGACAAGAGCTCCAAGTATAAG
ATGGGGGCCAAGCTGGGGCTCAAGGAGACGCCGGCGGGCGCGGGCCTCATGAGCTGCTTGGACAAGTTTCGCATT
CCACCGCCCACGATGCACATAGCAGTGTCGGCGGCCAAGGACTACTCGCAGGTGCCCGTCATGTGCCGCCTCGAG
CCATGCATGAGCATCGCTTCTGGCGTCAGCGCGCCCAAGATCATCACGGCCATTGGCAGCGACGGACTCAAGTAC
AAGCAGCTGGTCAAGGGCGGGCACGATGACCTGCGCCAGGACGCCATCATGGAGCAAGTCTTTGCCGCCGTGTCG
TCTCTGCTCCAGCTGCACAAGAGCACGCAGCAGCGCAGCCTGGGCATCCGGACCTACAAGGTGCTGCCCCTGACA
GCTACGTCGGGCCTCATCGAGTTTGTGGCCGACACGACGCCTCTGCACGAGTTTCTCATGCCTGCTCACGAGAGA
TACTTCCCGCGCGACATCAAATCGTCTGAGTGTAGAAAGGACATCTTTGCCGTCCAGAGCAAGACGTTTGAGGTG
CGCATGGACACGTATCGCAAGGTGACGCAGCGCTTCCACCCCGTCATGCGCTTCTTCTTCATGGAGCACTTTGTC
AACCCCGACGAGTGGTTTGCCAGGCAGCGGGCTTACACGAGGAGCACTGCCGCCGTGTCCATGCTGGGCCATGTG
CTGGGCCTGGGCGACCGCCACTGCCACAACATACTGCTCGACACCAAGACGGGCGAGGTGGTGCACATTGACCTG
GGCGTGGCCTTTGAGGCGGGGCGCATTCTGCCCGTGCCGGAGCTGGTGCCCTTTCGCCTGACGCGAGACATTGTT
GACGGCATGGGAATCACAAAGACCGAGGGTGTCTTTCGCCGCTGCTGCGAGTTTACCCTGCATGCCCTACGCGAG
GAGCAGTATTCCATCATGACCATTCTCGACGTCTTGCGCTACGATCCCCTTTACACGTGGACCGTTTCGCCCCTG
CGGCTAGCCAAGCTGAACAAGGCAAGGCAGAGCGACAGCGATGTCGGAGCTGCGCCGGATGATGCAGAGCCAAGA
GTCAAGGACACGAGGTCCAAGGGCAAGTGCAACGAGCCCTCTGAGGCTGATCGCGCACTCGAGGTGGTGCGCAAA
AAGCTGTCCAAGACGTTGAGCGTTACCGCCACCGTGAATGACTTGATTCATCAAGCCTCAGACGAACGGAACCTT
GCCGTTTTGTATTCTGGTTGGGCAGCGTGGGCTTGA
Gene >OphauB2|2629
ATGTCGTCGCCGCACATGTCAACCGTAAGAGACCTTGCCAGAGACATATCCACCGGCTCCATCAAAGACCGGGAT
AAGGCCATAGAGGGTAAGAGGCTTGTTTGTTAGTGCAGTTATAGCTACAGGGCTGCTGTTAACAAGCCTACTACT
AGATTTAACAAACCTCCTTCGAAACAACTCTGTCAACCTCACCGCTCTAGAAGATAAAAGCTATCATGATATCCT
AGAAGCAATCTTCAACGTAGTTCTGAAGGACAAGTCAGTCTACCATGGAAAGAAGAACTCGCAGTCTCGACGCAA
CAGTGCCGCCTCGCGCTTATCTAAATGCGCTACGGCTGTCAGGCTGGCTGTTTCTCGAGGCGTCTCCAAACTAAA
GCTCAAAACACTGCTTGCCGTGATAGACCACATCACGCAAACTCTTGTCGGTTTTGACAAAGAGTTCGTGGCGCC
TCTATTCCATGACTATGTCAAGGCCCTGGTAGCGGTGCTTTCGCGCCCAGCCCATGTCGAGCTCTTGGCCAGAAA
GGATGCCGTCGTTTGGCGGGCGTGCGTCGACTTTCTCATCAAAGTAGCCGAGGAGAGTCTTCCTGAAAAGCCAGC
CTCTTTAACTTGTTCGACAGGACCATCTCCTAGTTCGGCTGGGACAACACCAAGGCCGACAGCCCCTAGCCAGCG
ACGCACCAGCAGCCATGATGGAGGCCCTTTGCGTGACTCCCTTGTCGGTCTCCAATATTTGGTAGAGGCAGCAAA
TGCTCCGCTTGGGCACAAGGCCAAGCTTGTTACAGACTTGGCAGTCAAGGTCCTTGACCTACAAAATCTTAGTCT
GGGGCCGCTTCAAACCATGTCATTTGCTATTGCAAACACTACATTTGCTGCTACTGAAGCTGACGACTTCAACTT
TGCTTGTGGTCTCGTTAGGCAGCTGTTGCCCTTGATGAGTCATTGGTGGCGAGCCGACAAGGCCTCTCACGATGA
CCTCATTAGAGGCTTGAGGAACGAAATCTCCCGCAGTCTTTTCTTGATGCATTTGCATGTTCAACACTTGGCCAT
CAACTGCTGGGACGAAGGTGTGCGAGACCATGTCGAAAATCTAAGCGATACTTTATGGTCCGAGTACTCTAGAAG
ATGTCAGGACTTTGGGCTACAGCTCAATGACGTTACCTTCTACATGACTTCCTTGCCTTCGAATGCTTTGCGCCT
CGAAATCTTTGGTCTACACAACCATAGTGCTGAGGGAGAAGGCAACTGGGCTTTGCTTCAGAATCTTGGCTTTTT
AGAAGCAGTCATGATGCGTCCCAGACCTACAATGGGCCAAGTTGAGGACCAGGATGCAGACGGGCAATCTCGCAA
GAAGCCCCGCCTCGATAACGGAGGCTTGAGCCGCTTCAAGCTGAAATTGACGCTGAGAAATACAGCAGTTCAGAG
GACGGCTCTTCAGCTCATTCCCTTTCTCCTTGCCAACAATGCGCTGGAAATTGACAATATGGTGGAAATACTCAC
CGAGCTCACCACTTGTGCCTCGCGTAAGAACGCAGACAACGTGAGCTGGGCATTTGTTGCCTGCGCGAGGTAGGC
AACACCGAGGCGCATCTTGTAGTACTCTAGCTGATTCCTGACAGTTTACTTTCGATTCGCGCCATTGGTGACAGC
CAGAGCGATACTTGGAGGCAGCTCTGGCGCTTGGCATCTCGATGCCTCAGCCTCCCGTCCATGAGCCGTGCTGCC
TGTCTCCTGCTGCATGCCATACTCAAGGAACGTGTTCTCCCTGTGCACACGCTCTCAGGAGATATCAATAGCTTT
GTCACGGCTGCAGATGTTCATGGCCCTGCTGTGCTATGCGACACTTCAATGGCCTTGATGCTTCTTCTGTTCCAT
GAACGCAATGCGAGATTGCCAAATGCGAGCCAGACCACCAGCAGCCAAATCATCAGATGGGCATTTTTGAAGTGG
CTCCCTGGTCAGTGACGATTCTCATCCGCTTCCCCCCTCGTTTGCAACTGCAGCAACATCTGACTCTAAGCCCAA
GACGAGCCGAGCTATGCCACTTCTCACTCCATGCACGTACGGCCAATTCAGTATGTGAACCTGTTGCGGGCCTGT
TGCGGGCTGCATCCGATTTCGAGCCACAACCAGGATGTTATTGTCGGCTCGACTCTCAGCGCTGCCTGGAAGGTC
CAGGGTGACATTGCACCCTTCAATAAGTATCTTCTCCTTATTGCAGGCAGTCGACTGGAGCAAGACTCCAACGGC
CGAGATTCAGTTCCCACGACGAGTGCCCTTCTCAATTCCGACCCCAGCAGCTTTTATGCATCGAGAAATTTGGTT
GTCGAGCTCTTCCATCCCAAGCTCCAGGGACTCGTGGCGGCATGTAGCTCGTGGAGCAAAAGACCAGCCGACGGC
GGCAGCTCCATTTCACTAGAGTGGTTTCATAGTATCCTTTCTGCATGTATAGCTGGCGTCATGCTTGTGCCGCTA
GGCAGTGATGTCTGTCCGACACAATCGAGCTCAATGGAACAGAGCTTGATTGATATCGCCGAGAAGAGCATCATG
GCTGCCCTCAACTCGGTCGAGCCCGAAGTCTTTGTCTATACAGGTCTACAGCTGTTGCGCCAGTGCATCCCAAAT
ATCACCACGCACAATCTCAACCTGTTATACGACAGCAATAATGCTCTTGTCCGGATGCTGTGCAGAGTCTCCGGC
TGCCTTGAGCAGACAAGCACGGCGCCGGCATCCAATAACGGCGATTCTATGCATCTTGATGACGAGTTTGTTTCA
CAAGGCAGCAAAGCCATGGCAGCCACAGTTTCTACTCCGATCCCGAGACAGAATATTCAAATGGCCATGAGTGCT
CGGGCGTTCACCACCGAGACAAAAACACGCCTATGCTTGTTAAAAGCACTTGATCAAGAAAAGCAACAGTGCAGT
GAGATCCCGGACTGCTGGGTCAGAGAGCTCTTGTCAATGCCAGACAATGAGATTTTTCTCTGTCAAGGCCTGCTC
ATTGAGCTTTCTCGATCGGATCTGGCCATGACCTCAGACAATTTGCGACTATTGGTTAGGAGAATGGGCGAAATT
ATGGGCAAGCCGGAGTACCAATGTTGTGAAGTTGTCTTGTCGACATGCATCGAGATTCTGTCTGGCTGGCATCAG
ATTTGGCTTAATGACAGCGATAGGCTCGCCGAATACGCGGGTGATCTTTATACCCATTTTATCAAGATCAACATG
CCTTGCAACGTGTTCTCACCCCCAGCGCGAATGGCAATGGTCAATCTTCTGTTGACGCTTCTCAGGGCCAACCCA
GACTATGGAGAGCAACTCAAACTTGACTCTTGTCGAACGTCACTTTTATATGCCCTCAAAACGAGTACTGTCAAG
GTCAAGTGTTTCATCGCCGATCGTCTTGCCAGCATCTTTGAGCTGTACATCCTTGAGCTACACGAAGAAGTTTTT
GTCGATGTTCTGGAATGTCTACCTTCAGATGCAGAAGACAAGGCTGGTATCGTCTTCAGGCTGTTGGCTCTGTCC
AAGATGGCAATGTCGTGGCCCACATTGCTAAGGAGATGCGCTTATCACATCTTTGAGATTCCAGGCAAGATTCCA
TGGTCAACACAGCATGCCAAGTGGTGTCTGGCCCAAGTCTCGGACAGCTTGGGACTCGAATCTGCACAGGACCTG
TTCCGCCTCTTTTGCCGTCAGATTCTCTACACATGGATGGAATCAAACTCGATCGACACCATTCCCTTCTCCATC
TTTGGTTTCTGCGACTTGGAAGAGTTGCTCCAGTCGACTCGGGGCGAAGCAATTGCCATCGCTTTGATGAGAGGC
CAAGAGCAAGACAGCGCAGACATAGCAGAGGTCCTGGGGCTGAGTGAGACGGAGCTCATATTGGAAAATTTTCCA
GTGATTTTGTCCTATTGCATGATATACTCATATGCTTCGAGAGCTTCGAACCGAGGTGAAGACCGGATCAAGAGC
AAGTTGGGGCCCAAAAGGTACGCTGAAGCTCTCCATGCCAGCTTTGTCGATATTGTGGCGCTTTTCATGGGCCTT
GTGGACAATGAGGATCCCAATGAGAACGCCTTGAACAGGATCCCCGAGCTGGATTATGCTGTGCAAAGCATGGCG
GCTATTAAGCAAATTGCACACTCGAAAGCAAAGCTTCCTCCAGATCAGCAGCCCAAGTTTCGAGCAAAGCACGTT
TTTCCCAAGCTGCTCGAGCTGTGTAAGGTTACAGAATTCGAGCTCAGCCAGCTCTGGACTCCAGCTCTTGTAGCT
TCGGTTGTCCGAAAGCTCCTTGGCCGCATACACCCTGCCATGGGATCCCTAAATGCTTGTTCTGCTCTTCGAAAG
GTTCGCCTTCTGGTGTGTCTGGCAGGACCAACGGCCTTCAACTCTTACTGCCTGGAAATGCTTTTGAACTCTTTG
CGCGTCTTCATGGTCGACTCGGAATGTGCCGATGATGTTATAGGCGTCAGTGAGTATCTGCTTGGAAACGGCAAC
CCCTATCTCAGCGACAGACCGTGCTTCGTGGCAGGCTACGCTCTGTCAGCTCTGGCCTCTCTTCGAGTTTTTCTC
GAATCGAGCCAGTCGAGTACGACAGAAGAAGACCAGTTCAAAGCCACAATGATCAAGGCTCAACAATTTCATGCA
TGGCTAGTCAAATATTTATCCACATACAACTCGACGCGGTTCGTTAGCGTGTCCCAGCTTGAATCGTTTCAGGCC
ATTATTGAGACAGCAGGGCAGATCAAATCCTCGGGAAATGCAGACAATGGTTCTCCCGAGGGCAAGCTGCTCCTC
CACATCTTGAAAGACGACGAATCATGCCAGGGCCTCTTGAATGAATCCTCTCGCAAGCTTGCCTTAGGGCTACTT
TGTGGCGATTTCAACATGCCCACTGTCACTAATGACATGATTGAAAGCGACGACAAAGCCATCTGCCATGCCGGC
GCCGTGTGGAAGAGCTGCCAGTGGCCTGAACTCAGCTCCAACTATCTTGCCTGGGCCGGACGGGTAGTGGGGAGA
TCATTCGCAGCATCGGGAGGAATCCCAGACGGCATCCTACGCGAGTCACAGCTGGATGAATATCAGAGGATAGCA
CAGGAGCCCCATGGGTCTGAAGCAGCACTACTGCACTTGATTGAAGTAGTCACGTCGAACCAAGACTCTGGCGTT
GCAGGTCTTGCCGAGGCTGTCCTAAGGCTTATAGTATCCCAAGCAGATATGCGCCAGGACCAGACTCTTGCCGCA
ACACTTCAGAGAAGCCTATCCGAGTCTCTAGTTGCCGCCTCGAATTGGGACCAGTTTCCGTTGCCTCCATCAGAG
GTGCCTCTTAATGCCGTCTTCCAGCAGCCATGGCCACAAGACATTGGGTCCCCGGATTGGAAGGTTCAGCTCAGT
GTCTATCTGGCGCAGTCTGTGCCTGCATCTGTCTTGCTATCGGTGATGCCAGTGCTGCTCTCTCGTGTCGCAGGC
TTCGCCCACAAGGCGTTTCCGTTTCTTGTCCACATGGTGCTCTGCTCAGAGCTAGATGGACAACGGGTCATGCGG
CAGAATCTGTCAGGAGCCATCAAGAAGTGGTTGCCTACGACAGGTGCTGCTGCTCAAAGCAACCTGAGGCTTTTA
ATCAACACGATACTCTATCTCAGGACTCAAGAGTTCCCCAACGAGACTTCTATCGAGGATCGACTCCGCTGGCTG
AAAATCGACTTTGCTGAAGCAGCTTCAACAGCAACGCGCTGCGGCATGTACAAGACGGCACTTCTCTTTGCCGAG
ATTGCAATGTCCGAAGGCACGCCCTCGGCTCGGTCCTCTTGTCTGGCGGAAATGAAGAGCACATTGTTGACTATA
TACGAAAATATTGACGACCCCGACACCTACTACGGCCTCCCTGAAGAGGCTAGCCTGACCAATGTACTAGCCCGC
GTCGAGTATGAGCAAGAAGGATCCAAGAGCTTGGCATTCCGTGGAGCGCAGTACGATGAAAATATTCGTCTACGG
AGTGCGGACGCCCAAGGAGATGCCCAGGCGCTCGTTGTAGCACTCGGGACTTTGGGACACTCAGGAATCTCGCAT
TCAGTACTCCAAAATCAGCAAAATCTCGATGGCTCGGTAGCGTGTCTGGAAAGCACGTTTGGCACAGCAAGACGA
CTAGAGATTTGGGACCTGCCGGCGCCATGCAAGTGGGAGCATCATAGCGTATCCCTGTATAAAGCATACCAGGCA
CTTCATCAGGCCACTGAGCTGCCGCCAGTACGCTCAACGATTCATGATGGGCTGGGGCGCATAATGCAGGATTTG
GCTGGCTCTAATGACAATGCCACCAAGGTGCGAGGTCGACTGGCAGCGCTGGCATCACTAACAGAGCTTGAGGAT
GGTGTGCACGTTGGTGATGAAGATGCAATGGAGGTGTTGCTGTCAAAGTTCAAATTGCGAGACGGCTGGATGAGG
AGCGGGAGATACGACGACGTGAGCCAGATACTGTCTTGCCGGGAGACTATGACAAGCATGCTGAGCCAACACCCA
GCGCTTGTGAGTAGCCCTCGGTTCACAGTCAAGAATCTGAGGCAGCTGCAGGTGGAGACGATGCTCATGGCATCC
ACCATGTACCGCCATCACGGCGCCTTGCAGGAGTCGCTGGCCATTTCGACGGCGCTCAACAAGCTGATAGCCGTG
TGCCAAAGCTTGGAGCTCCATGTGGACGCTGCCATTGATATCGACATTGCCAACTCACTGTGGGACCATGGAGAG
ATGAGCACGTCAATACGCATGCTTCAGAAGATCGACAAGGACTCATGTCTGGAGGAGCAGAGTATTCCCGTCAGC
CGCTGCGTCTTGCTGTCCAAGATTGGTGACAAGATATCGATTGCGCGACTGGAGAAGCCCAGGGACATACAAAAG
ACTTATCTAGAGCCTGCGCTTAAAGAGCTTCGGCGACAGGAAAACCGCAGCAAGGAGGCCGGGGCCGTGTACCAT
CAGTTTGCCATGTTTTGCGACGGGCAGCTGCAGGACACGAATGGGCAAGAGGACTTGAAGAGACTGCACAGTCTG
CGGCAGGCAAAGAGCGACGAAGTGGCAGCACTCAAAGCGCTGATTGCTTCCACGACAGACAAACAGAACAAGTTG
CGCTACTCGCATGCGTTGGCCAAGGAGAAGCAGTGGCTGGATCTGGACGAGCAGGAGCTGAAGCGCGTGGAGCAG
ACACGAAGCGAGTTTGTACGGCTGAGCCTGGAAAACTACCTCTTGTCGATGCAAGCGTCGGACGACTACAAGAAT
GACGCGCTGCGCTTCACGGCGCTGTGGCTGGAGAGATGGGCAGAAGAGGCGACCAATAAGGCTGTCTCGCGCCAT
CTGCCGTGTGTGCCGACGGCCAAGTTTGCCGGGCTGATGAACCAGCTGTCGTCGCGGCTGCAGAACGAGCAGGGC
ATGTTCCAAAAGGTGCTCATGGATCTGGTGTACAGCATCTGTCGCGACCACCCCTACCACGGCATGTACCAAATC
TGGTCGGGCATCAAGGCCAAAGCGCAGGAGACGGACCAGGCGGCTGTGCTGCGCGTACAGGCGACTGAAAAGGTT
GCGCAGCGGCTGCAAAGCACGCAGGCCCTGGCCAAGATTTGGCTGGCGATTGACAAGACGAGCCGACAGTACCAT
GCCTTTGCCATGGACAAGAGCTCCAAGTATAAGATGGGGGCCAAGCTGGGGCTCAAGGAGACGCCGGCGGGCGCG
GGCCTCATGAGCTGCTTGGACAAGTTTCGCATTCCACCGCCCACGATGCACATAGCAGTGTCGGCGGCCAAGGAC
TACTCGCAGGTGCCCGTCATGTGCCGCCTCGAGCCATGCATGAGCATCGCTTCTGGCGTCAGCGCGCCCAAGATC
ATCACGGCCATTGGCAGCGACGGACTCAAGTACAAGCAGCTGGTCAAGGGCGGGCACGATGACCTGCGCCAGGAC
GCCATCATGGAGCAAGTCTTTGCCGCCGTGTCGTCTCTGCTCCAGCTGCACAAGAGCACGCAGCAGCGCAGCCTG
GGCATCCGGACCTACAAGGTGCTGCCCCTGACAGCTACGTCGGGCCTCATCGAGTTTGTGGCCGACACGACGCCT
CTGCACGAGTTTCTCATGCCTGCTCACGAGAGATACTTCCCGCGCGACATCAAATCGTCTGAGTGTAGAAAGGAC
ATCTTTGCCGTCCAGAGCAAGACGTTTGAGGTGCGCATGGACACGTATCGCAAGGTGACGCAGCGCTTCCACCCC
GTCATGCGCTTCTTCTTCATGGAGCACTTTGTCAACCCCGACGAGTGGTTTGCCAGGCAGCGGGCTTACACGAGG
AGCACTGCCGCCGTGTCCATGCTGGGCCATGTGCTGGGCCTGGGCGACCGCCACTGCCACAACATACTGCTCGAC
ACCAAGACGGGCGAGGTGGTGCACATTGACCTGGGCGTGGCCTTTGAGGCGGGGCGCATTCTGCCCGTGCCGGAG
CTGGTGCCCTTTCGCCTGACGCGAGACATTGTTGACGGCATGGGAATCACAAAGACCGAGGGTGTCTTTCGCCGC
TGCTGCGAGTTTACCCTGCATGCCCTACGCGAGGAGCAGTATTCCATCATGACCATTCTCGACGTCTTGCGCTAC
GATCCCCTTTACACGTGGACCGTTTCGCCCCTGCGGCTAGCCAAGCTGAACAAGGCAAGGCAGAGCGACAGCGAT
GTCGGAGCTGCGCCGGATGATGCAGAGCCAAGAGTCAAGGACACGAGGTCCAAGGGCAAGTGCAACGAGCCCTCT
GAGGCTGATCGCGCACTCGAGGTGGTGCGCAAAAAGCTGTCCAAGACGTTGAGCGTTACCGCCACCGTGAATGAC
TTGATTCATCAAGCCTCAGACGAACGGAACCTTGCCGTTTTGTATTCTGGTATGTGGTTTTTGTCTTGTAGTATG
CAGTATCCCGTGTGGTTGGGCCAAACGTGCTAATAGCAGACGGTTAGGTTGGGCAGCGTGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail