Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2628
Gene name
LocationContig_185:21418..26759
Strand-
Gene length (bp)5341
Transcript length (bp)5004
Coding sequence length (bp)5004
Protein length (aa) 1668

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11894 Nup192 Nuclear pore complex scaffold, nucleoporins 186/192/205 0.0E+00 6 1644

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S4T0|NU192_CHATD Nucleoporin NUP192 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP192 PE=1 SV=1 1 1667 0.0E+00
sp|P47054|NU192_YEAST Nucleoporin NUP192 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP192 PE=1 SV=1 411 1613 5.0E-65
sp|P78847|NU186_SCHPO Nucleoporin nup186 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup186 PE=2 SV=2 37 1120 4.0E-58
sp|P47054|NU192_YEAST Nucleoporin NUP192 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP192 PE=1 SV=1 53 376 2.0E-10
sp|Q92621|NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 305 1056 3.0E-07

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0140513 nuclear protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2255
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3179
Ophiocordyceps australis map64 (Brazil) OphauB2|2628 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01950
Ophiocordyceps camponoti-rufipedis Ophun1|3715
Ophiocordyceps kimflemingae Ophio5|5909
Ophiocordyceps subramaniannii Hirsu2|2924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2628
MADVTSLDALQAFHRELLALEDGFSEDIDCLGNDLLVRTFEQELEKLWDCPPRKEQSRNAVKSGKITFNGVEYQV
NQRFQQDVLVLSDELDLDELESAKYLLDSQNDLATLGRSLLECAVIRFHQQRKYLLDILRILLQLDSGESDVEED
SALEQVKMFVGNRVFRPGLVGPKRYVPRCMSTMATTRTWLQKLGDKIAAAQALSPDNAMGLSEEMETVEFSRLSL
IQQHELLGVIICQCIEKREAQVSDFLDFVSMLEKADKYDMLLIHLIPAIGAYISVFGSTEGACDLIQARELNSKL
LPPADDSTWPLPHVHAAFRVWWLAEYSGFYRDDPPEDALPPNTDLDQEDRERTKQFMDALKDGAFDLLLSVAADV
TPPDWHDAVRTGMRNWLLRRSTTLPSEPIQFSLFFQQCLMAQLEVFIDAFITNLPDVLRKLRVEEDEQRQLSQAH
EQDLDLERFLLIIAYTYEGRPDAALNFWSDPDSNLAGFMQWASRRASTPLVTAFCEMLQAISANAECATAAHEFL
LDESHGSSGKMRRALSLTWSQIFKELAFFSDKIKQKPTPAQTVRFRGPKMANEQMETEPESAMMLECYLRLMTKL
ASESEVARQFLQPNASHSLTAEMLFSLASSPIPPRLRGCVFMTLRALLTRKSRTESHAMWTCLETWVTGGYAAAA
AASLRHGQQNPPVPTERILNEMSNGFEDPESFIQLLLALISPSKDNSRLNDSLPFPDNLGSSSRYSGIEIYVDFV
VGMVFANKSQEIQDKHQLRMLRLSCLDFMLACLDSFNENLIIIANTTKLNIDSLVNTSDLATYVCKHPFGRVMEW
MYNDKVMKALFSTIHQEPADVGNAAPDSPLILGIQRAVEVISRVLDLEPTYQNLVKPRIKLQAISRREPVAHAAY
SSFADGLVTRLSLVVDLGRYCGMGYPDVTLACLKLLEKMSASSRIATSWSGSSRLAHRNKAIVALEANGEHEGIS
RAFVSELMAPLEASREANSPSYLAKLYILDFLLQCLQTTPNEPTIAHLLLGFRCGVDSLSVDAQGAFEQRTSLFH
CLLRLLFEIPCGDARGMRQWLITLKCRIMRILRILWSCRLSAPIVVKELRDEEFLFHLVIREPVIQSDLLWEGQE
VGHVEFTLTDGAPALVDFLALRSLTLEYIATELCLISQGRMPNVKRRIYEALNGQVMGEDNQFISTPTVFDLYDF
LLPDECWNLPPPSIQHHQNLDFSICAEEDADGNIVYNLDLVQNIILLKRNEQYGKPGSLVTRQEVVEIDKERASI
LSYLNSCNRRRQIAKQCLSVLKSWTRLLLIMVECNDLEGAAQTSFFLQALQAVLPSLDAFASDRPDEALELAKLA
RVLLCRFDAKSLDSGDSQSQAIGNLVGDKLYQLFQVCLQAIGSWAGSPELRSVYYEICYRYLNGNSEEAPLSTSH
PRTSKTIHVYGERLITVICDDAYGSQPACQAAALILLNALVYAGSCEDDDYVIETLNRLNFIGIVVDSLRDIMHE
WHHVFTSGNANQQHYQDARLALLLQIAESRTGAKYLVYANVFRTLETSGLFSADPELQSDVEDPRVLEQHYNLLA
KVARVIGAAVLSRGSHNANQGRKFLTDHRMLVTHTLKRSAGIGHVETNGMALEEHIGELADAFMVIIIATGFVKY
EVDEVAELTKSSRVLFH*
Coding >OphauB2|2628
ATGGCCGACGTGACGTCGCTTGATGCCTTGCAGGCTTTCCACCGAGAGCTCCTGGCCCTTGAGGATGGCTTTTCA
GAGGATATCGACTGTCTTGGCAATGACTTGTTAGTCCGCACATTTGAGCAAGAACTCGAAAAACTGTGGGATTGT
CCTCCGAGAAAGGAACAAAGCCGCAATGCGGTCAAGTCAGGCAAAATTACATTTAACGGCGTCGAGTATCAAGTA
AACCAAAGGTTTCAGCAAGACGTCCTTGTCCTCTCCGACGAACTCGATTTGGATGAGCTCGAGTCGGCAAAATAC
CTCCTCGATTCTCAAAACGACTTGGCAACCCTGGGACGAAGCTTGCTCGAGTGCGCAGTCATTCGCTTCCACCAA
CAACGAAAATACCTACTCGACATATTAAGGATACTTCTTCAGCTAGACAGCGGCGAAAGCGACGTCGAGGAAGAT
AGCGCGCTCGAACAAGTCAAAATGTTTGTTGGAAACCGTGTCTTCCGGCCGGGGCTTGTCGGGCCAAAACGATAC
GTGCCCCGATGCATGTCCACCATGGCCACGACTCGCACATGGCTGCAGAAGCTAGGCGACAAGATTGCAGCAGCC
CAGGCCCTGAGCCCAGACAATGCCATGGGGCTCTCTGAGGAGATGGAGACGGTTGAGTTTTCGCGCCTGAGCCTG
ATTCAGCAGCATGAGTTGTTGGGTGTCATTATTTGTCAGTGTATAGAGAAGCGCGAGGCCCAAGTGTCGGATTTC
CTTGACTTTGTTTCCATGCTGGAAAAGGCGGACAAGTACGACATGCTTTTGATCCACTTGATACCGGCTATTGGT
GCATATATATCCGTCTTTGGTTCTACAGAAGGCGCCTGTGATCTCATTCAAGCTCGCGAGCTAAACAGCAAGCTG
CTGCCGCCTGCAGACGATTCCACCTGGCCGTTGCCTCATGTACATGCCGCCTTTCGAGTATGGTGGCTTGCTGAG
TACAGTGGCTTCTACCGCGACGACCCCCCTGAAGACGCCTTGCCGCCCAATACAGACCTCGATCAAGAGGACCGC
GAGAGGACCAAGCAGTTCATGGATGCTCTTAAAGATGGCGCTTTTGATTTATTGCTCTCAGTGGCAGCAGATGTC
ACCCCGCCTGATTGGCACGACGCTGTTCGAACCGGTATGCGTAACTGGTTACTGCGAAGATCCACCACTTTGCCG
TCTGAGCCCATACAGTTTTCGCTCTTTTTTCAGCAGTGCCTCATGGCACAGCTCGAGGTCTTTATCGACGCCTTC
ATCACAAATCTCCCCGACGTGCTCCGAAAGCTTAGAGTGGAGGAAGACGAGCAGAGGCAACTGAGCCAGGCGCAC
GAGCAAGACTTGGATCTGGAGCGCTTCTTGCTCATCATTGCCTACACATATGAAGGTCGTCCCGATGCCGCACTC
AATTTCTGGTCAGATCCTGACAGCAATCTGGCGGGCTTTATGCAATGGGCATCTCGCCGGGCATCGACGCCCTTG
GTGACAGCATTTTGCGAAATGCTGCAAGCCATTTCTGCAAACGCCGAATGTGCTACGGCTGCTCACGAGTTTCTT
CTTGATGAGAGCCATGGTTCGTCTGGAAAGATGAGAAGGGCGCTCTCCTTGACGTGGTCCCAAATATTCAAAGAG
TTGGCTTTTTTCTCCGACAAGATTAAACAGAAGCCAACGCCTGCGCAGACTGTACGCTTCCGAGGACCCAAGATG
GCCAATGAACAAATGGAAACAGAGCCTGAATCAGCAATGATGCTGGAGTGCTATCTCCGTCTAATGACCAAGCTC
GCCAGTGAAAGCGAGGTGGCTAGGCAGTTTCTACAGCCAAATGCATCACATAGCCTGACTGCTGAAATGCTCTTC
TCCTTGGCGAGCAGCCCCATACCTCCTCGGCTCCGGGGCTGCGTCTTCATGACTCTCAGGGCTCTGCTTACACGC
AAGTCAAGAACAGAGAGCCATGCCATGTGGACCTGCTTGGAAACTTGGGTTACCGGCGGCTACGCAGCTGCTGCC
GCGGCATCTTTGCGCCACGGGCAACAAAATCCTCCAGTGCCGACAGAGCGCATCTTGAACGAGATGAGCAATGGT
TTTGAAGACCCCGAGTCGTTTATCCAGCTCTTGTTGGCTTTGATCAGCCCGTCAAAGGATAACAGCCGACTTAAT
GATTCGTTGCCTTTTCCCGACAACCTGGGCTCCAGTTCGCGATACTCGGGCATAGAAATCTATGTCGACTTTGTT
GTTGGCATGGTGTTTGCAAACAAGTCGCAGGAGATACAGGACAAGCACCAGTTACGCATGCTCAGGCTGAGCTGT
CTCGACTTTATGCTAGCCTGCCTTGACAGCTTTAACGAAAACCTCATCATCATTGCCAACACGACCAAACTCAAC
ATTGACTCATTGGTTAATACATCAGACTTGGCAACATATGTTTGCAAACATCCCTTTGGCAGGGTCATGGAGTGG
ATGTACAATGACAAGGTGATGAAGGCGCTCTTCAGTACCATTCATCAAGAGCCTGCAGATGTCGGAAACGCCGCT
CCAGACTCTCCGCTTATTCTTGGCATTCAACGCGCAGTCGAGGTTATTTCTCGAGTGCTCGATTTGGAGCCAACA
TACCAAAACTTGGTCAAGCCGCGTATCAAGCTGCAAGCTATTTCTAGGCGAGAACCTGTTGCCCATGCCGCATAC
TCTTCATTTGCAGATGGTCTGGTGACAAGGCTGAGCCTCGTTGTCGATTTGGGAAGATATTGCGGCATGGGCTAT
CCCGATGTTACTCTGGCCTGCCTTAAGCTACTAGAAAAAATGTCGGCTTCGTCTAGAATTGCAACTTCGTGGTCA
GGTTCAAGCAGACTGGCCCATCGCAACAAGGCCATTGTGGCATTGGAGGCGAATGGAGAGCATGAAGGCATATCC
CGAGCCTTCGTGTCAGAGCTCATGGCGCCTTTGGAGGCAAGCCGCGAGGCAAACTCGCCTAGTTACCTGGCCAAG
CTGTACATTCTCGACTTTCTTCTGCAATGTCTTCAGACGACGCCAAACGAGCCTACAATTGCCCATCTATTGCTT
GGTTTCCGATGCGGTGTCGACTCGCTATCAGTTGATGCTCAGGGTGCTTTTGAGCAAAGAACATCATTGTTTCAC
TGCTTGCTGAGGCTCTTGTTTGAGATACCATGTGGAGATGCAAGGGGAATGAGGCAGTGGCTCATTACCCTCAAG
TGTCGCATCATGCGGATATTACGCATCCTATGGTCATGTCGACTGTCAGCCCCGATTGTGGTCAAGGAACTACGA
GACGAGGAGTTTTTGTTTCACCTGGTGATTCGGGAGCCCGTTATCCAGTCCGATCTTCTATGGGAAGGCCAAGAA
GTTGGTCACGTCGAGTTTACCCTGACTGATGGCGCGCCAGCCCTGGTGGATTTCCTGGCATTGCGGAGTCTGACT
CTGGAATACATTGCCACGGAGCTTTGCTTGATTTCTCAAGGGCGCATGCCCAATGTCAAGAGACGCATCTACGAG
GCTCTCAATGGTCAAGTCATGGGCGAGGACAATCAGTTTATCAGTACACCAACCGTCTTTGACCTGTACGACTTT
CTGCTTCCGGATGAATGTTGGAATCTGCCACCGCCTTCAATTCAGCACCATCAAAACTTGGATTTTTCCATTTGT
GCCGAAGAGGATGCCGATGGCAATATCGTCTATAACTTGGATCTTGTACAAAACATCATTCTCCTCAAACGAAAC
GAGCAATACGGCAAGCCGGGAAGTCTGGTTACTCGTCAAGAAGTGGTTGAAATCGACAAGGAACGAGCCTCAATC
CTGTCATACTTGAATTCTTGCAACCGGCGCAGACAGATTGCCAAGCAGTGTCTGAGCGTCTTGAAGTCATGGACA
AGACTTTTACTCATCATGGTGGAGTGCAACGATCTCGAGGGAGCGGCACAAACGTCCTTTTTCTTGCAAGCTCTT
CAGGCTGTGCTCCCAAGCCTTGATGCTTTTGCGTCAGATCGTCCAGACGAGGCGCTGGAGCTGGCCAAGCTGGCC
AGGGTGTTGCTTTGCAGATTCGACGCCAAGTCGCTTGATAGCGGCGATTCGCAGAGCCAGGCCATTGGGAACCTT
GTTGGAGATAAACTATACCAATTATTTCAAGTATGTCTGCAAGCAATAGGCAGCTGGGCAGGCTCTCCTGAGCTC
AGATCAGTCTACTATGAGATTTGCTATCGCTATCTCAATGGCAATTCTGAGGAGGCGCCTCTTAGCACCAGCCAT
CCCAGGACCTCCAAGACTATTCACGTGTACGGCGAGAGGCTCATCACTGTAATATGCGATGATGCCTATGGCAGC
CAGCCTGCTTGTCAAGCCGCAGCCCTGATACTATTGAACGCTCTAGTCTATGCTGGAAGCTGCGAGGATGATGAC
TACGTTATCGAGACGCTAAACCGCCTCAACTTTATTGGAATTGTTGTCGACTCACTCCGAGACATTATGCACGAA
TGGCATCATGTTTTCACCTCAGGTAATGCTAATCAGCAGCATTATCAGGACGCCCGTCTGGCGCTTCTGCTGCAG
ATTGCAGAGTCTCGCACCGGGGCCAAGTACCTTGTCTATGCCAATGTTTTCCGCACACTCGAGACATCGGGCCTC
TTTTCTGCCGACCCTGAGCTCCAGAGCGATGTTGAAGACCCACGGGTTCTGGAGCAGCACTACAACTTGCTTGCC
AAGGTGGCGCGCGTCATTGGAGCCGCTGTTCTTAGTCGGGGCAGCCACAATGCCAATCAGGGCCGCAAGTTTCTG
ACGGACCACCGGATGCTTGTCACACATACACTCAAGCGGAGCGCAGGGATTGGGCACGTAGAGACCAATGGGATG
GCGCTGGAAGAACATATTGGCGAACTAGCAGATGCTTTCATGGTGATTATTATTGCAACGGGATTTGTCAAGTAC
GAGGTCGATGAAGTGGCAGAGTTGACCAAGTCGTCACGCGTCTTGTTCCATTGA
Transcript >OphauB2|2628
ATGGCCGACGTGACGTCGCTTGATGCCTTGCAGGCTTTCCACCGAGAGCTCCTGGCCCTTGAGGATGGCTTTTCA
GAGGATATCGACTGTCTTGGCAATGACTTGTTAGTCCGCACATTTGAGCAAGAACTCGAAAAACTGTGGGATTGT
CCTCCGAGAAAGGAACAAAGCCGCAATGCGGTCAAGTCAGGCAAAATTACATTTAACGGCGTCGAGTATCAAGTA
AACCAAAGGTTTCAGCAAGACGTCCTTGTCCTCTCCGACGAACTCGATTTGGATGAGCTCGAGTCGGCAAAATAC
CTCCTCGATTCTCAAAACGACTTGGCAACCCTGGGACGAAGCTTGCTCGAGTGCGCAGTCATTCGCTTCCACCAA
CAACGAAAATACCTACTCGACATATTAAGGATACTTCTTCAGCTAGACAGCGGCGAAAGCGACGTCGAGGAAGAT
AGCGCGCTCGAACAAGTCAAAATGTTTGTTGGAAACCGTGTCTTCCGGCCGGGGCTTGTCGGGCCAAAACGATAC
GTGCCCCGATGCATGTCCACCATGGCCACGACTCGCACATGGCTGCAGAAGCTAGGCGACAAGATTGCAGCAGCC
CAGGCCCTGAGCCCAGACAATGCCATGGGGCTCTCTGAGGAGATGGAGACGGTTGAGTTTTCGCGCCTGAGCCTG
ATTCAGCAGCATGAGTTGTTGGGTGTCATTATTTGTCAGTGTATAGAGAAGCGCGAGGCCCAAGTGTCGGATTTC
CTTGACTTTGTTTCCATGCTGGAAAAGGCGGACAAGTACGACATGCTTTTGATCCACTTGATACCGGCTATTGGT
GCATATATATCCGTCTTTGGTTCTACAGAAGGCGCCTGTGATCTCATTCAAGCTCGCGAGCTAAACAGCAAGCTG
CTGCCGCCTGCAGACGATTCCACCTGGCCGTTGCCTCATGTACATGCCGCCTTTCGAGTATGGTGGCTTGCTGAG
TACAGTGGCTTCTACCGCGACGACCCCCCTGAAGACGCCTTGCCGCCCAATACAGACCTCGATCAAGAGGACCGC
GAGAGGACCAAGCAGTTCATGGATGCTCTTAAAGATGGCGCTTTTGATTTATTGCTCTCAGTGGCAGCAGATGTC
ACCCCGCCTGATTGGCACGACGCTGTTCGAACCGGTATGCGTAACTGGTTACTGCGAAGATCCACCACTTTGCCG
TCTGAGCCCATACAGTTTTCGCTCTTTTTTCAGCAGTGCCTCATGGCACAGCTCGAGGTCTTTATCGACGCCTTC
ATCACAAATCTCCCCGACGTGCTCCGAAAGCTTAGAGTGGAGGAAGACGAGCAGAGGCAACTGAGCCAGGCGCAC
GAGCAAGACTTGGATCTGGAGCGCTTCTTGCTCATCATTGCCTACACATATGAAGGTCGTCCCGATGCCGCACTC
AATTTCTGGTCAGATCCTGACAGCAATCTGGCGGGCTTTATGCAATGGGCATCTCGCCGGGCATCGACGCCCTTG
GTGACAGCATTTTGCGAAATGCTGCAAGCCATTTCTGCAAACGCCGAATGTGCTACGGCTGCTCACGAGTTTCTT
CTTGATGAGAGCCATGGTTCGTCTGGAAAGATGAGAAGGGCGCTCTCCTTGACGTGGTCCCAAATATTCAAAGAG
TTGGCTTTTTTCTCCGACAAGATTAAACAGAAGCCAACGCCTGCGCAGACTGTACGCTTCCGAGGACCCAAGATG
GCCAATGAACAAATGGAAACAGAGCCTGAATCAGCAATGATGCTGGAGTGCTATCTCCGTCTAATGACCAAGCTC
GCCAGTGAAAGCGAGGTGGCTAGGCAGTTTCTACAGCCAAATGCATCACATAGCCTGACTGCTGAAATGCTCTTC
TCCTTGGCGAGCAGCCCCATACCTCCTCGGCTCCGGGGCTGCGTCTTCATGACTCTCAGGGCTCTGCTTACACGC
AAGTCAAGAACAGAGAGCCATGCCATGTGGACCTGCTTGGAAACTTGGGTTACCGGCGGCTACGCAGCTGCTGCC
GCGGCATCTTTGCGCCACGGGCAACAAAATCCTCCAGTGCCGACAGAGCGCATCTTGAACGAGATGAGCAATGGT
TTTGAAGACCCCGAGTCGTTTATCCAGCTCTTGTTGGCTTTGATCAGCCCGTCAAAGGATAACAGCCGACTTAAT
GATTCGTTGCCTTTTCCCGACAACCTGGGCTCCAGTTCGCGATACTCGGGCATAGAAATCTATGTCGACTTTGTT
GTTGGCATGGTGTTTGCAAACAAGTCGCAGGAGATACAGGACAAGCACCAGTTACGCATGCTCAGGCTGAGCTGT
CTCGACTTTATGCTAGCCTGCCTTGACAGCTTTAACGAAAACCTCATCATCATTGCCAACACGACCAAACTCAAC
ATTGACTCATTGGTTAATACATCAGACTTGGCAACATATGTTTGCAAACATCCCTTTGGCAGGGTCATGGAGTGG
ATGTACAATGACAAGGTGATGAAGGCGCTCTTCAGTACCATTCATCAAGAGCCTGCAGATGTCGGAAACGCCGCT
CCAGACTCTCCGCTTATTCTTGGCATTCAACGCGCAGTCGAGGTTATTTCTCGAGTGCTCGATTTGGAGCCAACA
TACCAAAACTTGGTCAAGCCGCGTATCAAGCTGCAAGCTATTTCTAGGCGAGAACCTGTTGCCCATGCCGCATAC
TCTTCATTTGCAGATGGTCTGGTGACAAGGCTGAGCCTCGTTGTCGATTTGGGAAGATATTGCGGCATGGGCTAT
CCCGATGTTACTCTGGCCTGCCTTAAGCTACTAGAAAAAATGTCGGCTTCGTCTAGAATTGCAACTTCGTGGTCA
GGTTCAAGCAGACTGGCCCATCGCAACAAGGCCATTGTGGCATTGGAGGCGAATGGAGAGCATGAAGGCATATCC
CGAGCCTTCGTGTCAGAGCTCATGGCGCCTTTGGAGGCAAGCCGCGAGGCAAACTCGCCTAGTTACCTGGCCAAG
CTGTACATTCTCGACTTTCTTCTGCAATGTCTTCAGACGACGCCAAACGAGCCTACAATTGCCCATCTATTGCTT
GGTTTCCGATGCGGTGTCGACTCGCTATCAGTTGATGCTCAGGGTGCTTTTGAGCAAAGAACATCATTGTTTCAC
TGCTTGCTGAGGCTCTTGTTTGAGATACCATGTGGAGATGCAAGGGGAATGAGGCAGTGGCTCATTACCCTCAAG
TGTCGCATCATGCGGATATTACGCATCCTATGGTCATGTCGACTGTCAGCCCCGATTGTGGTCAAGGAACTACGA
GACGAGGAGTTTTTGTTTCACCTGGTGATTCGGGAGCCCGTTATCCAGTCCGATCTTCTATGGGAAGGCCAAGAA
GTTGGTCACGTCGAGTTTACCCTGACTGATGGCGCGCCAGCCCTGGTGGATTTCCTGGCATTGCGGAGTCTGACT
CTGGAATACATTGCCACGGAGCTTTGCTTGATTTCTCAAGGGCGCATGCCCAATGTCAAGAGACGCATCTACGAG
GCTCTCAATGGTCAAGTCATGGGCGAGGACAATCAGTTTATCAGTACACCAACCGTCTTTGACCTGTACGACTTT
CTGCTTCCGGATGAATGTTGGAATCTGCCACCGCCTTCAATTCAGCACCATCAAAACTTGGATTTTTCCATTTGT
GCCGAAGAGGATGCCGATGGCAATATCGTCTATAACTTGGATCTTGTACAAAACATCATTCTCCTCAAACGAAAC
GAGCAATACGGCAAGCCGGGAAGTCTGGTTACTCGTCAAGAAGTGGTTGAAATCGACAAGGAACGAGCCTCAATC
CTGTCATACTTGAATTCTTGCAACCGGCGCAGACAGATTGCCAAGCAGTGTCTGAGCGTCTTGAAGTCATGGACA
AGACTTTTACTCATCATGGTGGAGTGCAACGATCTCGAGGGAGCGGCACAAACGTCCTTTTTCTTGCAAGCTCTT
CAGGCTGTGCTCCCAAGCCTTGATGCTTTTGCGTCAGATCGTCCAGACGAGGCGCTGGAGCTGGCCAAGCTGGCC
AGGGTGTTGCTTTGCAGATTCGACGCCAAGTCGCTTGATAGCGGCGATTCGCAGAGCCAGGCCATTGGGAACCTT
GTTGGAGATAAACTATACCAATTATTTCAAGTATGTCTGCAAGCAATAGGCAGCTGGGCAGGCTCTCCTGAGCTC
AGATCAGTCTACTATGAGATTTGCTATCGCTATCTCAATGGCAATTCTGAGGAGGCGCCTCTTAGCACCAGCCAT
CCCAGGACCTCCAAGACTATTCACGTGTACGGCGAGAGGCTCATCACTGTAATATGCGATGATGCCTATGGCAGC
CAGCCTGCTTGTCAAGCCGCAGCCCTGATACTATTGAACGCTCTAGTCTATGCTGGAAGCTGCGAGGATGATGAC
TACGTTATCGAGACGCTAAACCGCCTCAACTTTATTGGAATTGTTGTCGACTCACTCCGAGACATTATGCACGAA
TGGCATCATGTTTTCACCTCAGGTAATGCTAATCAGCAGCATTATCAGGACGCCCGTCTGGCGCTTCTGCTGCAG
ATTGCAGAGTCTCGCACCGGGGCCAAGTACCTTGTCTATGCCAATGTTTTCCGCACACTCGAGACATCGGGCCTC
TTTTCTGCCGACCCTGAGCTCCAGAGCGATGTTGAAGACCCACGGGTTCTGGAGCAGCACTACAACTTGCTTGCC
AAGGTGGCGCGCGTCATTGGAGCCGCTGTTCTTAGTCGGGGCAGCCACAATGCCAATCAGGGCCGCAAGTTTCTG
ACGGACCACCGGATGCTTGTCACACATACACTCAAGCGGAGCGCAGGGATTGGGCACGTAGAGACCAATGGGATG
GCGCTGGAAGAACATATTGGCGAACTAGCAGATGCTTTCATGGTGATTATTATTGCAACGGGATTTGTCAAGTAC
GAGGTCGATGAAGTGGCAGAGTTGACCAAGTCGTCACGCGTCTTGTTCCATTGA
Gene >OphauB2|2628
ATGGCCGACGTGACGTCGCTTGATGCCTTGCAGGCTTTCCACCGAGAGCTCCTGGCCCTTGAGGATGGCTTTTCA
GAGGATATCGACTGTCTTGGCAATGACTTGTTAGTCCGCACATTTGAGCAAGAACTCGAAAAACTGTGGGATTGT
CCTCCGAGAAAGGAACAAAGCCGCAATGCGGTCAAGTCAGGTATGCAACACGTAGCTGCCCCTTGAGAGGGCAGT
CGACTCATTGATTGCAGGCAAAATTACATTTAACGGCGTCGAGTATCAAGTAAACCAAAGGTTTCAGCAAGACGT
CCTTGTCCTCTCCGACGAACTCGATTTGGATGAGCTCGAGTCGGCAAAATACCTCCTCGATTCTCAAAACGACTT
GGCAACCCTGGGACGAAGCTTGCTCGAGTGCGCAGTCATTCGCTTCCACCAACAACGAAAATACCTACTCGACAT
ATTAAGGATACTTCTTCAGCTAGACAGCGGCGAAAGCGACGTCGAGGAAGATAGCGCGCTCGAACAAGTCAAAAT
GTTTGTTGGAAACCGTGTCTTCCGGCCGGGGCTTGTCGGGCCAAAACGATACGTGCCCCGATGCATGTCCACCAT
GGCCACGACTCGCACATGGCTGCAGAAGCTAGGCGACAAGATTGCAGCAGCCCAGGCCCTGAGCCCAGACAATGC
CATGGGGCTCTCTGAGGAGATGGAGACGGTTGAGTTTTCGCGCCTGAGCCTGATTCAGCAGCATGAGTTGTTGGG
TGTCATTATTTGTCAGTGTATAGAGAAGCGCGAGGCCCAAGTGTCGGATTTCCTTGACTTTGTTTCCATGCTGGA
AAAGGCGGACAAGTACGACATGCTTTTGAGTAAGTCTGGCCTACAATCAGAACCACTGAGTGCTCACTTGCTAAC
GTCGCGAGTTCTCAAGTCCACTTGATACCGGCTATTGGTGCATATATATCCGTCTTTGGTTCTACAGAAGGCGCC
TGTGATCTCATTCAAGCTCGCGAGCTAAACAGCAAGCTGCTGCCGCCTGCAGACGATTCCACCTGGCCGTTGCCT
CATGTACATGCCGCCTTTCGAGTATGGTGGCTTGCTGAGTACAGTGGCTTCTACCGCGACGACCCCCCTGAAGAC
GCCTTGCCGCCCAATACAGACCTCGATCAAGGTGAGACTACTGGAGCACGTGGACAGATGTAATGAGGGCTGAAA
CTATAACAGAGGACCGCGAGAGGACCAAGCAGTTCATGGATGCTCTTAAAGATGGCGCTTTTGATTTATTGCTCT
CAGTGGCAGCAGATGTCACCCCGCCTGATTGGCACGACGCTGTTCGAACCGGTATGCGTAACTGGTTACTGCGAA
GATCCACCACTTTGCCGTCTGAGCCCATACAGTTTTCGCTCTTTTTTCAGCAGTGCCTCATGGCACAGCTCGAGG
TCTTTATCGACGCCTTCATCACAAATCTCCCCGACGTGCTCCGAAAGCTTAGAGTGGAGGAAGACGAGCAGAGGC
AACTGAGCCAGGCGCACGAGCAAGACTTGGATCTGGAGCGCTTCTTGCTCATCATTGCCTACACATATGAAGGTC
GTCCCGATGCCGCACTCAATTTCTGGTCAGATCCTGACAGCAATCTGGCGGGCTTTATGCAATGGGCATCTCGCC
GGGCATCGACGCCCTTGGTGACAGCATTTTGCGAAATGCTGCAAGCCATTTCTGCAAACGCCGAATGTGCTACGG
CTGCTCACGAGTTTCTTCTTGATGAGAGCCATGGTTCGTCTGGAAAGATGAGAAGGGCGCTCTCCTTGACGTGGT
CCCAAATATTCAAAGAGTTGGCTTTTTTCTCCGACAAGATTAAACAGAAGCCAACGCCTGCGCAGACTGTACGCT
TCCGAGGACCCAAGATGGCCAATGAACAAATGGAAACAGAGCCTGAATCAGCAATGATGCTGGAGTGCTATCTCC
GTCTAATGACCAAGCTCGCCAGTGAAAGCGAGGTGGCTAGGCAGTTTCTACAGCCAAATGCATCACATAGCCTGA
CTGCTGAAATGCTCTTCTCCTTGGCGAGCAGCCCCATACCTCCTCGGCTCCGGGGCTGCGTCTTCATGACTCTCA
GGGCTCTGCTTACACGCAAGTCAAGAACAGAGAGCCATGCCATGTGGACCTGCTTGGAAACTTGGGTTACCGGCG
GCTACGCAGCTGCTGCCGCGGCATCTTTGCGCCACGGGCAACAAAATCCTCCAGTGCCGACAGAGCGCATCTTGA
ACGAGATGAGCAATGGTTTTGAAGACCCCGAGTCGTTTATCCAGCTCTTGTTGGCTTTGATCAGCCCGTCAAAGG
ATAACAGCCGACTTAATGATTCGTTGCCTTTTCCCGACAACCTGGGCTCCAGTTCGCGATACTCGGGCATAGAAA
TCTATGTCGACTTTGTTGTTGGCATGGTGTTTGCAAACAAGTCGCAGGAGATACAGGACAAGCACCAGTTACGCA
TGCTCAGGCTGAGCTGTCTCGACTTTATGCTAGCCTGCCTTGACAGCTTTAACGAAAACCTCATCATCATTGCCA
ACACGACCAAACTCAACATTGACTCATTGGTTAATACATCAGACTTGGCAACATATGTTTGCAAACATCCCTTTG
GCAGGGTCATGGAGTGGATGTACAATGACAAGGTGATGAAGGCGCTCTTCAGTACCATTCATCAAGAGCCTGCAG
ATGTCGGAAACGCCGCTCCAGACTCTCCGCTTATTCTTGGCATTCAACGCGCAGTCGAGGTTATTTCTCGAGTGC
TCGATTTGGAGCCAACATACCAAAACTTGGTCAAGCCGCGTATCAAGCTGCAAGCTATTTCTAGGCGAGAACCTG
TTGCCCATGCCGCATACTCTTCATTTGCAGATGGTCTGGTGACAAGGCTGAGCCTCGTTGTCGATTTGGGAAGAT
ATTGCGGCATGGGCTATCCCGATGTTACTCTGGCCTGCCTTAAGCTACTAGAAAAAATGTCGGCTTCGTCTAGAA
TTGCAACTTCGTGGTCAGGTTCAAGCAGACTGGCCCATCGCAACAAGGCCATTGTGGCATTGGAGGCGAATGGAG
AGCATGAAGGCATATCCCGAGCCTTCGTGTCAGAGCTCATGGCGCCTTTGGAGGCAAGCCGCGAGGCAAACTCGC
CTAGTTACCTGGCCAAGCTGTACATTCTCGACTTTCTTCTGCAATGTCTTCAGACGACGCCAAACGAGCCTACAA
TTGCCCATCTATTGCTTGGTTTCCGATGCGGTGTCGACTCGCTATCAGTTGATGCTCAGGGTGCTTTTGAGCAAA
GAACATCATTGTTTCACTGCTTGCTGAGGCTCTTGTTTGAGATACCATGTGGAGATGCAAGGGGAATGAGGCAGT
GGCTCATTACCCTCAAGTGTCGCATCATGCGGATATTACGCATCCTATGGTCATGTCGACTGTCAGCCCCGATTG
TGGTCAAGGAACTACGAGACGAGGAGTTTTTGTTTCACCTGGTGATTCGGGAGCCCGTTATCCAGTCCGATCTTC
TATGGGAAGGCCAAGAAGTTGGTCACGTCGAGTTTACCCTGACTGATGGCGCGCCAGCCCTGGTGGATTTCCTGG
CATTGCGGAGTCTGACTCTGGAATACATTGCCACGGAGCTTTGCTTGATTTCTCAAGGGCGCATGCCCAATGTCA
AGAGACGCATCTACGAGGCTCTCAATGGTCAAGTCATGGGCGAGGACAATCAGTTTATCAGTACACCAACCGTCT
TTGACCTGTACGACTTTCTGCTTCCGGATGAATGTTGGAATCTGCCACCGCCTTCAATTCAGCACCATCAAAACT
TGGATTTTTCCATTTGTGCCGAAGAGGATGCCGATGGCAATATCGTCTATAACTTGGATCTTGTACAAAACATCA
TTCTCCTCAAACGAAACGAGCAATACGGCAAGCCGGGAAGTCTGGTTACTCGTCAAGAAGTGGTTGAAATCGACA
AGGAACGAGCCTCAATCCTGTCATACTTGAATTCTTGCAACCGGCGCAGACAGATTGCCAAGCAGTGTCTGAGCG
TCTTGAAGTCATGGACAAGACTTTTACTCATCATGGTGGAGTGCAACGATCTCGAGGGAGCGGCACAAACGTCCT
TTTTCTTGCAAGCTCTTCAGGCTGTGCTCCCAAGCCTTGATGCTTTTGCGTCAGATCGTCCAGACGAGGCGCTGG
AGCTGGCCAAGCTGGCCAGGGTGTTGCTTTGCAGATTCGACGCCAAGTCGCTTGATAGCGGCGATTCGCAGAGCC
AGGCCATTGGGAACCTTGTTGGAGATAAACTATACCAATTATTTCAAGTATGTCTGCAAGCAATAGGCAGCTGGG
CAGGCTCTCCTGAGCTCAGATCAGTCTACTATGAGATTTGCTATCGCTATCTCAATGGCAATTCTGAGGAGGCGC
CTCTTAGCACCAGCCATCCCAGGACCTCCAAGACTATTCACGTGTACGGCGAGAGGCTCATCACTGTAATATGCG
ATGATGCCTATGGCAGCCAGCCTGCTTGTCAAGCCGCAGCCCTGATACTATTGAACGCTCTAGTCTATGCTGGAA
GCTGCGAGGATGATGACTACGTTATCGAGACGCTAAACCGCCTCAACTTTATTGGAATTGTTGTCGACTCACTCC
GAGACATTATGCACGAATGGCATCATGTTTTCACCTCAGGTGCATAACTCTTATTATTTACTGTCTAGCACTGAC
ATGAGTGCCCAGCTAACATGAAGTCTCCTTTTTCTTCTTGTTTTTAGGTAATGCTAATCAGCAGCATTATCAGGA
CGCCCGTCTGGCGCTTCTGCTGCAGATTGCAGAGTCTCGCACCGGGGCCAAGTACCTTGTCTATGCCAATGTTTT
CCGCACACTCGAGACATCGGGCCTCTTTTCTGCCGACCCTGAGCTCCAGAGCGATGTTGAAGACCCACGGGTTCT
GGAGCAGCACTACAACTTGCTTGCCAAGGTGGCGCGCGTCATTGGAGCCGCTGTTCTTAGTCGGGGCAGCCACAA
TGCCAATCAGGGCCGCAAGTTTCTGACGGACCACCGGATGCTTGTCACACATACACTCAAGCGGAGCGCAGGGAT
TGGGCACGTAGAGACCAATGGGATGGCGCTGGAAGAACATATTGGCGAACTAGCAGATGCTTTCATGGTGATTAT
TATTGCAACGGGATTTGTCAAGGTGAGTCACGGAGAGACAAAAAGGCTGCATTGGGCATCATGGAGTTGTGCCTA
ATCTAAAGCTTGGCTGACGAGGCGTGGTGCACAGTACGAGGTCGATGAAGTGGCAGAGTTGACCAAGTCGTCACG
CGTCTTGTTCCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail