Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2626
Gene name
LocationContig_185:14774..18304
Strand-
Gene length (bp)3530
Transcript length (bp)3483
Coding sequence length (bp)3483
Protein length (aa) 1161

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18136 DNApol_Exo DNA mitochondrial polymerase exonuclease domain 2.2E-104 124 402
PF00476 DNA_pol_A DNA polymerase family A 1.6E-37 604 981

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y767|DPOG_NEUCR DNA polymerase gamma, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mip-1 PE=3 SV=2 4 1094 0.0E+00
sp|Q12704|DPOG_SCHPO DNA polymerase gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mip1 PE=3 SV=2 72 1022 0.0E+00
sp|P15801|DPOG_YEAST DNA polymerase gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP1 PE=1 SV=3 67 1075 0.0E+00
sp|Q01941|DPOG_PICPA DNA polymerase gamma OS=Komagataella pastoris GN=MIP1 PE=3 SV=1 69 1055 0.0E+00
sp|Q92076|DPOG1_CHICK DNA polymerase subunit gamma-1 (Fragment) OS=Gallus gallus GN=POLG PE=2 SV=1 589 1024 2.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y767|DPOG_NEUCR DNA polymerase gamma, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mip-1 PE=3 SV=2 4 1094 0.0E+00
sp|Q12704|DPOG_SCHPO DNA polymerase gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mip1 PE=3 SV=2 72 1022 0.0E+00
sp|P15801|DPOG_YEAST DNA polymerase gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIP1 PE=1 SV=3 67 1075 0.0E+00
sp|Q01941|DPOG_PICPA DNA polymerase gamma OS=Komagataella pastoris GN=MIP1 PE=3 SV=1 69 1055 0.0E+00
sp|Q92076|DPOG1_CHICK DNA polymerase subunit gamma-1 (Fragment) OS=Gallus gallus GN=POLG PE=2 SV=1 589 1024 2.0E-139
sp|P54098|DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens GN=POLG PE=1 SV=1 589 1024 4.0E-135
sp|Q9QYV8|DPOG1_RAT DNA polymerase subunit gamma-1 OS=Rattus norvegicus GN=Polg PE=2 SV=1 589 1024 1.0E-134
sp|P54099|DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus GN=Polg PE=1 SV=3 589 1024 2.0E-134
sp|Q91684|DPOG1_XENLA DNA polymerase subunit gamma-1 OS=Xenopus laevis GN=polg PE=2 SV=1 589 1020 1.0E-129
sp|Q27607|DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster GN=tam PE=1 SV=2 584 1023 3.0E-112
sp|Q9QYV8|DPOG1_RAT DNA polymerase subunit gamma-1 OS=Rattus norvegicus GN=Polg PE=2 SV=1 61 557 5.0E-76
sp|P54098|DPOG1_HUMAN DNA polymerase subunit gamma-1 OS=Homo sapiens GN=POLG PE=1 SV=1 72 557 1.0E-75
sp|Q91684|DPOG1_XENLA DNA polymerase subunit gamma-1 OS=Xenopus laevis GN=polg PE=2 SV=1 68 557 1.0E-75
sp|P54099|DPOG1_MOUSE DNA polymerase subunit gamma-1 OS=Mus musculus GN=Polg PE=1 SV=3 43 557 3.0E-72
sp|Q27607|DPOG1_DROME DNA polymerase subunit gamma-1, mitochondrial OS=Drosophila melanogaster GN=tam PE=1 SV=2 74 557 9.0E-66
sp|O67779|DPO1_AQUAE DNA polymerase I OS=Aquifex aeolicus (strain VF5) GN=polA PE=3 SV=1 681 939 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006260 DNA replication Yes
GO:0003887 DNA-directed DNA polymerase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034061 DNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0005488 binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006259 DNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0016740 transferase activity No
GO:0046483 heterocycle metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2253
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3181
Ophiocordyceps australis map64 (Brazil) OphauB2|2626 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01948
Ophiocordyceps camponoti-rufipedis Ophun1|3717
Ophiocordyceps kimflemingae Ophio5|5911
Ophiocordyceps subramaniannii Hirsu2|2922

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2626
MVALAPVSAHVQHASTAHFVRIARHHGICRHALGTQLRGLANVASNSSVKKKTRKKKASEQPSSLAVASESRFNE
IGVQQLSSHIFKQIFPDGCKPPPKELVELSKDHLKRHDLLGKATDGSAPIAFDLPPLKGRTLDEHFFKLGSDCAE
PFLSFAKQFMRANLPPKPRKWVRRSGWTKYYPDGQTEQVDFPDEEMLCFDTESLWKESPFSVMACAASPTAWYAW
ISPWLLGETDNDRQLIPLGDPSKPRIIVGHNVGYDRARVLEEYHVKQSQNSFLDTMSLHVAVNGMCSQQRPTWMK
HKKNRELRERIASETPDHDLATLLSNSSIHEEEELWIERSSINSLRDVAKFHLNVAIDKAVRDDFEQLDRAGVLE
KLDVLFDYCAADVSVTHRVYKIVFPNFTNVCPHPVSFAALRHLSSVILPVNKSWDAYIANAEATYHKLSSAVQER
LIGLAEKALEIKDKPEECSSDPWMMQLDWSGQEIRMIKGKKKDDPPRPAARQKKPGMPKWYKDLFAKNDSPIGIT
VRTRIAPLLLKMAWDGKPLFWSNQYGWTFRVPKCETEKYTARQMIMCVFDETDLVLRDDDAHSYFKLPHKDGPSA
RCASPMAKGYLPYFESGTLSSEYPYAKEALEMNASCSYWISARDRIMSQLVLYKSELPQAPQRTSGKKVTKGSRK
TKTKDMDEGFILPQIIPMGTITRRAVENTWLTASNAKKNRVGSELKAMVRAPKGYCFVGADVDSQELWIASLVGD
STFKIHGGNAVGFMTLEGTKAAGTDLHSRTAGILGISRNDAKVFNYGRIYGAGLKFASTLLRQFNPMLTEKETSE
TASRLYQNTKGTKTSRKILYKRPFWRGGTESFVFNKLEEFAEHERPRTPVLGAAITEALLGRYVSKGGYLTSRIN
WAIQSSGVDYLHLLIVSMDYLIRQFNLEARLAITVHDEIRYLVKEEDKYRAALALQVANVWTRSMFAQQVGINDL
PQSCAFFSAVDIDHVLRKEVDMDCITPSHPTAIASGESLDIKALLDKGSDAMLDSAIEADAKLKPKVDAIEYKPR
VPVMQDMQLNSADSLDFIKAQLATRDDELRILVSNVRRAEAAAASKTKPLNKQALRGVLPYRAYPLLTPMEEPMS
VADAVKAKYRNGQQGNSQWSWTRASGKGSSSTSRI*
Coding >OphauB2|2626
ATGGTTGCGCTCGCCCCCGTTTCTGCTCATGTTCAGCACGCTTCAACAGCACACTTTGTTCGCATAGCGCGCCAT
CATGGCATTTGCCGCCACGCCTTGGGGACCCAGCTCCGCGGGCTGGCCAATGTCGCCAGCAACTCAAGTGTCAAG
AAGAAGACGAGGAAGAAGAAGGCCTCTGAGCAGCCGAGCAGCTTAGCTGTCGCATCCGAGTCGCGCTTCAACGAA
ATTGGCGTACAGCAGCTCAGCTCTCACATTTTCAAGCAAATCTTCCCCGATGGCTGCAAGCCCCCTCCCAAGGAG
CTCGTCGAGTTATCCAAGGACCATTTGAAGCGGCACGACCTTCTCGGCAAGGCTACTGATGGGTCAGCGCCAATC
GCCTTTGACCTTCCTCCTCTCAAGGGTCGGACTCTGGACGAGCACTTTTTCAAACTAGGTTCAGACTGCGCCGAG
CCATTTCTATCTTTTGCGAAACAGTTTATGCGCGCCAACTTGCCGCCCAAACCGAGAAAATGGGTGCGACGCAGC
GGCTGGACAAAGTACTATCCAGATGGACAGACGGAGCAAGTGGATTTCCCAGACGAGGAAATGCTGTGCTTCGAC
ACCGAGTCTCTGTGGAAAGAAAGCCCCTTTTCCGTCATGGCTTGCGCTGCTAGTCCGACTGCCTGGTACGCCTGG
ATATCCCCTTGGTTGCTGGGCGAGACGGACAATGATCGTCAGCTCATTCCTCTCGGCGACCCGAGCAAGCCGCGA
ATCATTGTTGGCCACAATGTTGGCTACGATCGTGCCAGAGTGCTGGAGGAGTATCATGTCAAGCAATCACAAAAT
TCCTTTCTCGATACCATGTCACTACACGTGGCCGTCAACGGCATGTGTTCGCAGCAACGACCGACTTGGATGAAA
CACAAGAAGAACCGCGAGCTGAGGGAACGAATCGCTTCTGAGACGCCAGACCACGACCTCGCCACCCTCTTGAGC
AACAGCAGTATACACGAAGAGGAGGAGCTGTGGATCGAGCGGAGTTCCATCAACTCGTTGCGCGACGTGGCCAAA
TTTCACCTCAATGTTGCTATAGACAAGGCAGTTCGCGATGACTTTGAGCAGCTTGATCGAGCTGGCGTCTTGGAG
AAGCTCGATGTGCTTTTTGACTACTGCGCCGCCGACGTTTCCGTCACACACCGCGTCTACAAGATTGTTTTCCCC
AACTTTACCAATGTTTGCCCACATCCAGTCAGCTTTGCTGCGTTGCGGCATTTGTCTTCTGTCATTCTTCCGGTT
AATAAGTCGTGGGACGCCTACATTGCCAACGCCGAAGCAACCTATCACAAGCTGTCCAGCGCTGTGCAAGAGAGA
TTAATAGGTCTCGCGGAAAAGGCGCTTGAAATCAAGGACAAGCCAGAAGAATGTAGCAGCGATCCCTGGATGATG
CAACTCGACTGGTCTGGCCAAGAGATTCGCATGATCAAGGGGAAGAAAAAGGACGACCCTCCACGGCCAGCAGCA
CGACAGAAGAAGCCGGGCATGCCAAAGTGGTACAAGGACCTTTTTGCCAAGAACGACTCTCCCATTGGCATCACG
GTACGGACTCGCATAGCACCTCTGCTTCTCAAAATGGCGTGGGATGGCAAGCCACTCTTTTGGTCAAACCAATAT
GGCTGGACCTTTAGGGTGCCGAAATGCGAGACGGAAAAGTATACGGCCAGGCAAATGATTATGTGTGTCTTTGAT
GAAACAGATCTCGTGTTACGGGATGATGATGCGCACTCTTATTTCAAGCTTCCACACAAGGATGGGCCTTCTGCT
CGTTGTGCGAGCCCAATGGCAAAGGGGTATTTGCCATATTTCGAGAGCGGAACCTTGTCATCCGAGTATCCGTAT
GCCAAGGAGGCTTTGGAGATGAATGCTTCCTGCTCATATTGGATTAGCGCACGAGACCGCATCATGTCTCAGCTC
GTTCTCTACAAGAGCGAGTTGCCACAAGCGCCACAGCGGACAAGCGGAAAAAAGGTGACGAAAGGATCAAGGAAG
ACCAAGACAAAGGACATGGATGAAGGGTTCATCCTGCCCCAAATTATACCCATGGGAACGATTACAAGACGAGCT
GTGGAGAATACGTGGCTAACGGCAAGCAACGCCAAGAAGAACCGCGTTGGATCAGAACTCAAGGCCATGGTCAGA
GCACCAAAGGGGTACTGTTTTGTGGGCGCCGACGTTGACTCGCAAGAGCTGTGGATTGCCAGCCTAGTGGGCGAT
TCAACCTTTAAGATTCATGGAGGCAATGCAGTTGGCTTCATGACTCTTGAAGGTACCAAGGCTGCCGGCACAGAC
TTGCACTCCCGAACAGCAGGCATTTTGGGCATTTCACGAAACGATGCCAAAGTATTCAATTACGGGCGCATTTAT
GGAGCAGGACTCAAGTTTGCGTCAACGCTGTTGCGGCAGTTCAACCCGATGCTGACTGAAAAGGAGACTTCGGAG
ACAGCGTCGAGGCTGTACCAAAATACAAAGGGCACCAAGACGAGCCGAAAGATTCTCTACAAGCGACCCTTTTGG
CGCGGAGGGACCGAGTCGTTTGTCTTCAACAAGCTTGAAGAGTTTGCCGAGCATGAGCGACCACGAACTCCGGTG
CTTGGGGCTGCCATCACAGAGGCGCTCTTGGGTCGCTATGTCAGCAAGGGGGGCTATCTGACATCACGCATCAAC
TGGGCCATCCAGTCGTCGGGCGTCGACTATCTTCACCTGCTCATTGTGTCGATGGACTACTTGATTAGGCAGTTC
AACCTCGAGGCTCGTCTGGCGATTACGGTTCATGACGAAATCCGCTACCTGGTCAAGGAAGAGGACAAGTACCGG
GCGGCTCTGGCTTTGCAGGTAGCCAATGTTTGGACGCGATCCATGTTTGCACAGCAGGTTGGCATCAATGACTTG
CCGCAGTCGTGCGCCTTCTTTTCGGCCGTGGACATTGACCATGTGCTACGCAAGGAGGTCGACATGGACTGCATC
ACGCCCAGTCACCCTACAGCAATTGCATCCGGCGAGAGCTTGGACATCAAGGCGCTGCTCGACAAGGGCAGCGAT
GCCATGCTGGATAGCGCCATTGAAGCGGATGCCAAGCTCAAGCCAAAGGTGGACGCCATTGAGTACAAGCCGCGT
GTGCCGGTGATGCAGGACATGCAGCTCAACTCGGCAGACAGCCTCGACTTTATCAAGGCACAGCTGGCGACGCGT
GATGACGAGCTGCGCATCCTTGTCAGCAATGTGAGAAGAGCAGAGGCTGCGGCAGCTTCAAAGACGAAGCCTCTG
AACAAGCAGGCATTGCGAGGAGTGCTGCCATACCGGGCTTATCCCTTGCTGACACCAATGGAAGAACCCATGTCT
GTTGCTGATGCTGTCAAGGCCAAGTATCGCAACGGACAGCAGGGCAACAGCCAGTGGTCGTGGACGAGAGCATCG
GGCAAGGGCTCGAGTTCGACTTCGAGAATATGA
Transcript >OphauB2|2626
ATGGTTGCGCTCGCCCCCGTTTCTGCTCATGTTCAGCACGCTTCAACAGCACACTTTGTTCGCATAGCGCGCCAT
CATGGCATTTGCCGCCACGCCTTGGGGACCCAGCTCCGCGGGCTGGCCAATGTCGCCAGCAACTCAAGTGTCAAG
AAGAAGACGAGGAAGAAGAAGGCCTCTGAGCAGCCGAGCAGCTTAGCTGTCGCATCCGAGTCGCGCTTCAACGAA
ATTGGCGTACAGCAGCTCAGCTCTCACATTTTCAAGCAAATCTTCCCCGATGGCTGCAAGCCCCCTCCCAAGGAG
CTCGTCGAGTTATCCAAGGACCATTTGAAGCGGCACGACCTTCTCGGCAAGGCTACTGATGGGTCAGCGCCAATC
GCCTTTGACCTTCCTCCTCTCAAGGGTCGGACTCTGGACGAGCACTTTTTCAAACTAGGTTCAGACTGCGCCGAG
CCATTTCTATCTTTTGCGAAACAGTTTATGCGCGCCAACTTGCCGCCCAAACCGAGAAAATGGGTGCGACGCAGC
GGCTGGACAAAGTACTATCCAGATGGACAGACGGAGCAAGTGGATTTCCCAGACGAGGAAATGCTGTGCTTCGAC
ACCGAGTCTCTGTGGAAAGAAAGCCCCTTTTCCGTCATGGCTTGCGCTGCTAGTCCGACTGCCTGGTACGCCTGG
ATATCCCCTTGGTTGCTGGGCGAGACGGACAATGATCGTCAGCTCATTCCTCTCGGCGACCCGAGCAAGCCGCGA
ATCATTGTTGGCCACAATGTTGGCTACGATCGTGCCAGAGTGCTGGAGGAGTATCATGTCAAGCAATCACAAAAT
TCCTTTCTCGATACCATGTCACTACACGTGGCCGTCAACGGCATGTGTTCGCAGCAACGACCGACTTGGATGAAA
CACAAGAAGAACCGCGAGCTGAGGGAACGAATCGCTTCTGAGACGCCAGACCACGACCTCGCCACCCTCTTGAGC
AACAGCAGTATACACGAAGAGGAGGAGCTGTGGATCGAGCGGAGTTCCATCAACTCGTTGCGCGACGTGGCCAAA
TTTCACCTCAATGTTGCTATAGACAAGGCAGTTCGCGATGACTTTGAGCAGCTTGATCGAGCTGGCGTCTTGGAG
AAGCTCGATGTGCTTTTTGACTACTGCGCCGCCGACGTTTCCGTCACACACCGCGTCTACAAGATTGTTTTCCCC
AACTTTACCAATGTTTGCCCACATCCAGTCAGCTTTGCTGCGTTGCGGCATTTGTCTTCTGTCATTCTTCCGGTT
AATAAGTCGTGGGACGCCTACATTGCCAACGCCGAAGCAACCTATCACAAGCTGTCCAGCGCTGTGCAAGAGAGA
TTAATAGGTCTCGCGGAAAAGGCGCTTGAAATCAAGGACAAGCCAGAAGAATGTAGCAGCGATCCCTGGATGATG
CAACTCGACTGGTCTGGCCAAGAGATTCGCATGATCAAGGGGAAGAAAAAGGACGACCCTCCACGGCCAGCAGCA
CGACAGAAGAAGCCGGGCATGCCAAAGTGGTACAAGGACCTTTTTGCCAAGAACGACTCTCCCATTGGCATCACG
GTACGGACTCGCATAGCACCTCTGCTTCTCAAAATGGCGTGGGATGGCAAGCCACTCTTTTGGTCAAACCAATAT
GGCTGGACCTTTAGGGTGCCGAAATGCGAGACGGAAAAGTATACGGCCAGGCAAATGATTATGTGTGTCTTTGAT
GAAACAGATCTCGTGTTACGGGATGATGATGCGCACTCTTATTTCAAGCTTCCACACAAGGATGGGCCTTCTGCT
CGTTGTGCGAGCCCAATGGCAAAGGGGTATTTGCCATATTTCGAGAGCGGAACCTTGTCATCCGAGTATCCGTAT
GCCAAGGAGGCTTTGGAGATGAATGCTTCCTGCTCATATTGGATTAGCGCACGAGACCGCATCATGTCTCAGCTC
GTTCTCTACAAGAGCGAGTTGCCACAAGCGCCACAGCGGACAAGCGGAAAAAAGGTGACGAAAGGATCAAGGAAG
ACCAAGACAAAGGACATGGATGAAGGGTTCATCCTGCCCCAAATTATACCCATGGGAACGATTACAAGACGAGCT
GTGGAGAATACGTGGCTAACGGCAAGCAACGCCAAGAAGAACCGCGTTGGATCAGAACTCAAGGCCATGGTCAGA
GCACCAAAGGGGTACTGTTTTGTGGGCGCCGACGTTGACTCGCAAGAGCTGTGGATTGCCAGCCTAGTGGGCGAT
TCAACCTTTAAGATTCATGGAGGCAATGCAGTTGGCTTCATGACTCTTGAAGGTACCAAGGCTGCCGGCACAGAC
TTGCACTCCCGAACAGCAGGCATTTTGGGCATTTCACGAAACGATGCCAAAGTATTCAATTACGGGCGCATTTAT
GGAGCAGGACTCAAGTTTGCGTCAACGCTGTTGCGGCAGTTCAACCCGATGCTGACTGAAAAGGAGACTTCGGAG
ACAGCGTCGAGGCTGTACCAAAATACAAAGGGCACCAAGACGAGCCGAAAGATTCTCTACAAGCGACCCTTTTGG
CGCGGAGGGACCGAGTCGTTTGTCTTCAACAAGCTTGAAGAGTTTGCCGAGCATGAGCGACCACGAACTCCGGTG
CTTGGGGCTGCCATCACAGAGGCGCTCTTGGGTCGCTATGTCAGCAAGGGGGGCTATCTGACATCACGCATCAAC
TGGGCCATCCAGTCGTCGGGCGTCGACTATCTTCACCTGCTCATTGTGTCGATGGACTACTTGATTAGGCAGTTC
AACCTCGAGGCTCGTCTGGCGATTACGGTTCATGACGAAATCCGCTACCTGGTCAAGGAAGAGGACAAGTACCGG
GCGGCTCTGGCTTTGCAGGTAGCCAATGTTTGGACGCGATCCATGTTTGCACAGCAGGTTGGCATCAATGACTTG
CCGCAGTCGTGCGCCTTCTTTTCGGCCGTGGACATTGACCATGTGCTACGCAAGGAGGTCGACATGGACTGCATC
ACGCCCAGTCACCCTACAGCAATTGCATCCGGCGAGAGCTTGGACATCAAGGCGCTGCTCGACAAGGGCAGCGAT
GCCATGCTGGATAGCGCCATTGAAGCGGATGCCAAGCTCAAGCCAAAGGTGGACGCCATTGAGTACAAGCCGCGT
GTGCCGGTGATGCAGGACATGCAGCTCAACTCGGCAGACAGCCTCGACTTTATCAAGGCACAGCTGGCGACGCGT
GATGACGAGCTGCGCATCCTTGTCAGCAATGTGAGAAGAGCAGAGGCTGCGGCAGCTTCAAAGACGAAGCCTCTG
AACAAGCAGGCATTGCGAGGAGTGCTGCCATACCGGGCTTATCCCTTGCTGACACCAATGGAAGAACCCATGTCT
GTTGCTGATGCTGTCAAGGCCAAGTATCGCAACGGACAGCAGGGCAACAGCCAGTGGTCGTGGACGAGAGCATCG
GGCAAGGGCTCGAGTTCGACTTCGAGAATATGA
Gene >OphauB2|2626
ATGGTTGCGCTCGCCCCCGTTTCTGCTCATGTTCAGCACGCTTCAACAGCACACTTTGTTCGCATAGCGCGCCAT
CATGGCATTTGCCGCCACGCCTTGGGGACCCAGCTCCGCGGGCTGGCCAATGTCGCCAGCAACTCAAGTGTCAAG
AAGAAGACGAGGAAGAAGAAGGCCTCTGAGCAGCCGAGCAGCTTAGCTGGTAAGTGTCTCTGGTGGCTATTATTG
AGCTGGCGCTAACCTGCTCAGTCGCATCCGAGTCGCGCTTCAACGAAATTGGCGTACAGCAGCTCAGCTCTCACA
TTTTCAAGCAAATCTTCCCCGATGGCTGCAAGCCCCCTCCCAAGGAGCTCGTCGAGTTATCCAAGGACCATTTGA
AGCGGCACGACCTTCTCGGCAAGGCTACTGATGGGTCAGCGCCAATCGCCTTTGACCTTCCTCCTCTCAAGGGTC
GGACTCTGGACGAGCACTTTTTCAAACTAGGTTCAGACTGCGCCGAGCCATTTCTATCTTTTGCGAAACAGTTTA
TGCGCGCCAACTTGCCGCCCAAACCGAGAAAATGGGTGCGACGCAGCGGCTGGACAAAGTACTATCCAGATGGAC
AGACGGAGCAAGTGGATTTCCCAGACGAGGAAATGCTGTGCTTCGACACCGAGTCTCTGTGGAAAGAAAGCCCCT
TTTCCGTCATGGCTTGCGCTGCTAGTCCGACTGCCTGGTACGCCTGGATATCCCCTTGGTTGCTGGGCGAGACGG
ACAATGATCGTCAGCTCATTCCTCTCGGCGACCCGAGCAAGCCGCGAATCATTGTTGGCCACAATGTTGGCTACG
ATCGTGCCAGAGTGCTGGAGGAGTATCATGTCAAGCAATCACAAAATTCCTTTCTCGATACCATGTCACTACACG
TGGCCGTCAACGGCATGTGTTCGCAGCAACGACCGACTTGGATGAAACACAAGAAGAACCGCGAGCTGAGGGAAC
GAATCGCTTCTGAGACGCCAGACCACGACCTCGCCACCCTCTTGAGCAACAGCAGTATACACGAAGAGGAGGAGC
TGTGGATCGAGCGGAGTTCCATCAACTCGTTGCGCGACGTGGCCAAATTTCACCTCAATGTTGCTATAGACAAGG
CAGTTCGCGATGACTTTGAGCAGCTTGATCGAGCTGGCGTCTTGGAGAAGCTCGATGTGCTTTTTGACTACTGCG
CCGCCGACGTTTCCGTCACACACCGCGTCTACAAGATTGTTTTCCCCAACTTTACCAATGTTTGCCCACATCCAG
TCAGCTTTGCTGCGTTGCGGCATTTGTCTTCTGTCATTCTTCCGGTTAATAAGTCGTGGGACGCCTACATTGCCA
ACGCCGAAGCAACCTATCACAAGCTGTCCAGCGCTGTGCAAGAGAGATTAATAGGTCTCGCGGAAAAGGCGCTTG
AAATCAAGGACAAGCCAGAAGAATGTAGCAGCGATCCCTGGATGATGCAACTCGACTGGTCTGGCCAAGAGATTC
GCATGATCAAGGGGAAGAAAAAGGACGACCCTCCACGGCCAGCAGCACGACAGAAGAAGCCGGGCATGCCAAAGT
GGTACAAGGACCTTTTTGCCAAGAACGACTCTCCCATTGGCATCACGGTACGGACTCGCATAGCACCTCTGCTTC
TCAAAATGGCGTGGGATGGCAAGCCACTCTTTTGGTCAAACCAATATGGCTGGACCTTTAGGGTGCCGAAATGCG
AGACGGAAAAGTATACGGCCAGGCAAATGATTATGTGTGTCTTTGATGAAACAGATCTCGTGTTACGGGATGATG
ATGCGCACTCTTATTTCAAGCTTCCACACAAGGATGGGCCTTCTGCTCGTTGTGCGAGCCCAATGGCAAAGGGGT
ATTTGCCATATTTCGAGAGCGGAACCTTGTCATCCGAGTATCCGTATGCCAAGGAGGCTTTGGAGATGAATGCTT
CCTGCTCATATTGGATTAGCGCACGAGACCGCATCATGTCTCAGCTCGTTCTCTACAAGAGCGAGTTGCCACAAG
CGCCACAGCGGACAAGCGGAAAAAAGGTGACGAAAGGATCAAGGAAGACCAAGACAAAGGACATGGATGAAGGGT
TCATCCTGCCCCAAATTATACCCATGGGAACGATTACAAGACGAGCTGTGGAGAATACGTGGCTAACGGCAAGCA
ACGCCAAGAAGAACCGCGTTGGATCAGAACTCAAGGCCATGGTCAGAGCACCAAAGGGGTACTGTTTTGTGGGCG
CCGACGTTGACTCGCAAGAGCTGTGGATTGCCAGCCTAGTGGGCGATTCAACCTTTAAGATTCATGGAGGCAATG
CAGTTGGCTTCATGACTCTTGAAGGTACCAAGGCTGCCGGCACAGACTTGCACTCCCGAACAGCAGGCATTTTGG
GCATTTCACGAAACGATGCCAAAGTATTCAATTACGGGCGCATTTATGGAGCAGGACTCAAGTTTGCGTCAACGC
TGTTGCGGCAGTTCAACCCGATGCTGACTGAAAAGGAGACTTCGGAGACAGCGTCGAGGCTGTACCAAAATACAA
AGGGCACCAAGACGAGCCGAAAGATTCTCTACAAGCGACCCTTTTGGCGCGGAGGGACCGAGTCGTTTGTCTTCA
ACAAGCTTGAAGAGTTTGCCGAGCATGAGCGACCACGAACTCCGGTGCTTGGGGCTGCCATCACAGAGGCGCTCT
TGGGTCGCTATGTCAGCAAGGGGGGCTATCTGACATCACGCATCAACTGGGCCATCCAGTCGTCGGGCGTCGACT
ATCTTCACCTGCTCATTGTGTCGATGGACTACTTGATTAGGCAGTTCAACCTCGAGGCTCGTCTGGCGATTACGG
TTCATGACGAAATCCGCTACCTGGTCAAGGAAGAGGACAAGTACCGGGCGGCTCTGGCTTTGCAGGTAGCCAATG
TTTGGACGCGATCCATGTTTGCACAGCAGGTTGGCATCAATGACTTGCCGCAGTCGTGCGCCTTCTTTTCGGCCG
TGGACATTGACCATGTGCTACGCAAGGAGGTCGACATGGACTGCATCACGCCCAGTCACCCTACAGCAATTGCAT
CCGGCGAGAGCTTGGACATCAAGGCGCTGCTCGACAAGGGCAGCGATGCCATGCTGGATAGCGCCATTGAAGCGG
ATGCCAAGCTCAAGCCAAAGGTGGACGCCATTGAGTACAAGCCGCGTGTGCCGGTGATGCAGGACATGCAGCTCA
ACTCGGCAGACAGCCTCGACTTTATCAAGGCACAGCTGGCGACGCGTGATGACGAGCTGCGCATCCTTGTCAGCA
ATGTGAGAAGAGCAGAGGCTGCGGCAGCTTCAAAGACGAAGCCTCTGAACAAGCAGGCATTGCGAGGAGTGCTGC
CATACCGGGCTTATCCCTTGCTGACACCAATGGAAGAACCCATGTCTGTTGCTGATGCTGTCAAGGCCAAGTATC
GCAACGGACAGCAGGGCAACAGCCAGTGGTCGTGGACGAGAGCATCGGGCAAGGGCTCGAGTTCGACTTCGAGAA
TATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail