Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2618
Gene name
LocationContig_184:27091..30432
Strand-
Gene length (bp)3341
Transcript length (bp)3282
Coding sequence length (bp)3282
Protein length (aa) 1094

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17406 Nrap_D5 Nrap protein PAP/OAS1-like domain 5 3.3E-56 785 939
PF17405 Nrap_D4 Nrap protein nucleotidyltransferase domain 4 5.5E-53 596 782
PF17403 Nrap_D2 Nrap protein PAP/OAS-like domain 1.3E-45 289 432
PF03813 Nrap Nrap protein domain 1 1.7E-41 140 283
PF17404 Nrap_D3 Nrap protein domain 3 7.0E-35 455 574
PF17407 Nrap_D6 Nrap protein domain 6 2.1E-27 942 1078

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94676|UTP22_SCHPO U3 small nucleolar RNA-associated protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp22 PE=3 SV=1 5 1080 5.0E-134
sp|P53254|UTP22_YEAST U3 small nucleolar RNA-associated protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP22 PE=1 SV=1 27 1080 2.0E-120
sp|Q8R5K4|NOL6_MOUSE Nucleolar protein 6 OS=Mus musculus GN=Nol6 PE=2 SV=2 28 1079 5.0E-88
sp|Q9H6R4|NOL6_HUMAN Nucleolar protein 6 OS=Homo sapiens GN=NOL6 PE=1 SV=2 28 1079 1.0E-84
sp|Q6NRY2|NOL6_XENLA Nucleolar protein 6 OS=Xenopus laevis GN=nol6 PE=2 SV=2 28 1079 2.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94676|UTP22_SCHPO U3 small nucleolar RNA-associated protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp22 PE=3 SV=1 5 1080 5.0E-134
sp|P53254|UTP22_YEAST U3 small nucleolar RNA-associated protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP22 PE=1 SV=1 27 1080 2.0E-120
sp|Q8R5K4|NOL6_MOUSE Nucleolar protein 6 OS=Mus musculus GN=Nol6 PE=2 SV=2 28 1079 5.0E-88
sp|Q9H6R4|NOL6_HUMAN Nucleolar protein 6 OS=Homo sapiens GN=NOL6 PE=1 SV=2 28 1079 1.0E-84
sp|Q6NRY2|NOL6_XENLA Nucleolar protein 6 OS=Xenopus laevis GN=nol6 PE=2 SV=2 28 1079 2.0E-75
sp|Q5M7P5|NOL6_XENTR Nucleolar protein 6 OS=Xenopus tropicalis GN=nol6 PE=2 SV=1 28 1079 1.0E-67
sp|B4NIM9|NOL6_DROWI Nucleolar protein 6 OS=Drosophila willistoni GN=Mat89Ba PE=3 SV=1 26 1027 3.0E-51
sp|Q295U7|NOL6_DROPS Nucleolar protein 6 OS=Drosophila pseudoobscura pseudoobscura GN=Mat89Ba PE=3 SV=2 114 1027 6.0E-51
sp|B4GFN6|NOL6_DROPE Nucleolar protein 6 OS=Drosophila persimilis GN=Mat89Ba PE=3 SV=1 114 1027 1.0E-50
sp|B4PR18|NOL6_DROYA Nucleolar protein 6 OS=Drosophila yakuba GN=Mat89Ba PE=3 SV=1 26 1051 4.0E-48
sp|B4QX57|NOL6_DROSI Nucleolar protein 6 OS=Drosophila simulans GN=Mat89Ba PE=3 SV=1 26 1051 4.0E-46
sp|Q8IH00|NOL6_DROME Nucleolar protein 6 OS=Drosophila melanogaster GN=Mat89Ba PE=1 SV=1 26 1035 4.0E-46
sp|B4IBY3|NOL6_DROSE Nucleolar protein 6 OS=Drosophila sechellia GN=Mat89Ba PE=3 SV=1 26 1051 1.0E-44
sp|B4LWT7|NOL6_DROVI Nucleolar protein 6 OS=Drosophila virilis GN=Mat89Ba PE=3 SV=1 5 1035 9.0E-44
sp|B4K5S6|NOL6_DROMO Nucleolar protein 6 OS=Drosophila mojavensis GN=Mat89Ba PE=3 SV=1 110 1035 5.0E-41
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1244
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1166
Ophiocordyceps australis map64 (Brazil) OphauB2|2618 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03214
Ophiocordyceps camponoti-rufipedis Ophun1|4920
Ophiocordyceps kimflemingae Ophio5|5371
Ophiocordyceps subramaniannii Hirsu2|10440

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2618
MECHSKRRKLNHIASNAPSHSLIDFEARNSAQLSAANTLVLEAHDLLNESRPDAKTFEGADTLLRQIKDIIDSIE
PHDAVPIAQATVQLEKTHCVIAPYPDPPPRPDAQYKVSFAKPTQCNVVGSYVSKSMIKAQDSLAIDMVVQMPKSL
FQDKDYMDMRYFYRRSYYIAYIAAHVGKHLGNMFKLAFEHLNENPLLPLLLIRPLASNHGCPTSEAPHECNTPYT
IRLIPCAPHHLFPWSKLTPSSNCNRQRHQSCSVPTPFYNSTLNGEQAFIPYLRFLCQARSVCPAFADACILGRIW
LQQRGFGGGLSQGGFGHFEWAVLMALLLSTDARDGKATLSTSLSSTELFKAVIHFLSTTHLLKNPVVFGTSGANA
KAIQQEGPVIFDGDRQLNILFKTTPWSIALLQLYAKMTTDLLADDPVDKFDAIFINKADIAPLVFDACFELSLGA
TTDRRNFSFRAHGILRRAYGSRAQLVHFSTRKREPWPLGCRAPDETSNLTISIIFNPAEMSRNMEYGPRAEEQEE
GASFRRFWGEKAELRRFKDGRILECVEWKMGLPSEICHQVLCYSLGRHMGISSDDVVVRGLDMSTIIGPCHHDKD
AYDAARRAFTVLEREMRSLEELPLQIKQLCPVSPMASYSSTPVPTLAFHGDFSKAMDVIVYFEASSKWPENLVAI
QEAKIEFLLDIDKRLMAAHSNMTTSLGRENGITAIENLAYLDIVYDTGAAFRLRIHCDVEESLLERQSRNKTLNH
HVREASAQARDEFCWLYKTLPLHTQTVATLCTRLEALSQSIRLVKHWFASHMLSRHFSEQLIELLALHVFLEPYP
WPVPTSPTTGFLRILLFLSRWNWRDEPLIIDWADSLTCDDRAAIRNRVDLWRRRDAQMNKTVLFVATSSEPSGLA
YTHKGPCRLVASRMTRLAKAACRLMRNQTCRLEAASLFQSSLRDFDVLIRLSPRAVKAAVSGAATAASGKRHSHF
TNIHIGIGKTPLPLRLHPVDVLAAELQRVYQDTLVFFGGSSQDLVLAAIWNPRLQHRQKPRAGLPYNFCTEPNAN
GFHGDVVVNRGAILLEIARVGGDLIKAIEVLDDCGTGQGDTQL*
Coding >OphauB2|2618
ATGGAGTGCCATTCGAAGCGTCGAAAGCTCAATCACATTGCTTCCAATGCTCCCTCCCATAGTCTCATCGACTTT
GAAGCCCGAAACTCGGCACAGCTGTCAGCGGCCAACACTCTTGTCCTCGAGGCCCATGACCTTTTGAACGAGTCA
CGACCCGACGCCAAAACCTTTGAGGGTGCTGACACTCTGCTCCGTCAAATCAAAGATATTATCGACTCGATTGAA
CCTCACGATGCTGTTCCAATTGCGCAAGCGACTGTCCAGCTCGAGAAAACGCACTGCGTTATTGCCCCCTATCCA
GACCCACCACCTCGTCCAGATGCACAATACAAAGTCTCGTTTGCCAAGCCGACGCAATGCAATGTCGTCGGCAGC
TACGTCTCCAAGTCGATGATCAAGGCTCAAGACTCTTTAGCCATTGACATGGTGGTTCAAATGCCCAAGTCGTTG
TTCCAAGACAAGGACTACATGGATATGCGCTACTTTTACCGCAGGAGCTATTATATCGCCTACATCGCGGCGCAC
GTGGGCAAACATCTTGGCAACATGTTCAAGTTGGCCTTTGAGCACCTCAACGAGAACCCTCTACTTCCTCTTCTC
CTCATTCGGCCTTTGGCTTCCAATCATGGCTGCCCGACCAGTGAAGCTCCACATGAGTGCAACACCCCTTATACT
ATCAGGCTGATACCTTGTGCTCCTCATCACCTTTTCCCCTGGTCCAAACTCACACCGTCGTCAAACTGTAATCGA
CAGCGCCACCAGAGTTGCTCTGTCCCGACCCCTTTTTACAACTCGACTCTTAATGGGGAGCAAGCATTCATACCA
TATCTCCGTTTCCTTTGCCAGGCCAGAAGCGTGTGCCCAGCCTTTGCAGATGCCTGCATCCTGGGAAGAATTTGG
CTTCAGCAGCGTGGGTTCGGTGGTGGCCTTTCCCAAGGCGGCTTTGGTCATTTTGAATGGGCTGTGCTTATGGCC
CTTTTATTGTCCACAGACGCCCGTGATGGAAAGGCGACTCTGTCAACGTCTCTAAGCAGCACCGAGCTTTTCAAG
GCTGTCATTCACTTCCTATCTACTACACATCTTTTGAAGAACCCTGTAGTCTTTGGCACATCTGGAGCAAATGCC
AAGGCTATTCAACAAGAGGGCCCTGTCATCTTTGATGGAGACAGGCAGCTCAACATTTTGTTCAAGACAACGCCA
TGGTCGATAGCCTTGCTCCAACTCTACGCAAAAATGACTACTGATTTGCTCGCGGACGACCCCGTGGACAAATTT
GATGCAATATTCATAAACAAGGCAGATATAGCTCCTCTAGTCTTTGATGCTTGCTTTGAGCTGTCCCTTGGAGCG
ACTACCGACAGACGCAACTTCAGCTTTAGGGCACATGGCATACTCAGACGCGCATATGGCTCACGTGCGCAGTTG
GTTCACTTCTCAACTCGGAAGCGTGAGCCTTGGCCTCTTGGGTGCAGAGCTCCCGACGAGACGTCAAACTTGACC
ATCAGCATCATATTTAACCCTGCTGAAATGTCTCGCAACATGGAGTACGGGCCTCGTGCTGAGGAACAAGAGGAA
GGCGCATCCTTCCGTCGATTTTGGGGCGAAAAGGCTGAACTACGACGCTTCAAAGACGGCAGAATTCTCGAATGT
GTTGAGTGGAAGATGGGATTGCCTTCTGAGATTTGTCACCAAGTCCTTTGCTACAGTCTCGGACGTCACATGGGC
ATCTCGAGTGACGATGTGGTGGTGCGAGGGCTCGATATGAGTACAATTATAGGCCCATGTCACCACGACAAGGAC
GCGTATGATGCTGCTAGGCGAGCATTTACGGTGCTGGAGCGCGAGATGCGCAGCCTGGAAGAGTTGCCACTCCAA
ATCAAGCAACTATGTCCTGTGTCGCCAATGGCCAGCTATTCGTCCACGCCGGTTCCAACACTGGCTTTCCATGGA
GACTTTTCAAAAGCCATGGACGTCATTGTATACTTTGAGGCTTCGAGCAAGTGGCCGGAAAATCTGGTTGCCATT
CAAGAAGCCAAGATTGAGTTTCTCCTTGACATTGACAAGAGGTTGATGGCAGCACATAGCAACATGACTACAAGC
CTTGGCCGGGAAAATGGCATCACGGCCATTGAGAACCTGGCCTACCTCGACATTGTCTACGATACGGGCGCTGCC
TTTCGGCTCAGGATACACTGTGACGTTGAGGAATCGCTGCTTGAGCGACAATCAAGGAATAAGACGCTCAATCAC
CACGTACGCGAAGCGTCGGCCCAAGCTCGAGACGAGTTTTGCTGGTTGTACAAGACACTGCCTCTACACACGCAG
ACAGTGGCTACACTATGTACCAGACTCGAGGCACTGTCTCAGTCAATACGGCTTGTCAAACACTGGTTTGCGAGC
CACATGCTGAGTCGCCACTTTAGCGAACAGCTCATTGAGCTTCTTGCACTTCACGTATTCCTGGAACCCTATCCC
TGGCCCGTCCCAACGTCCCCGACAACGGGCTTCCTGCGAATACTCTTGTTTCTCTCGCGATGGAATTGGAGGGAC
GAGCCTTTAATCATTGACTGGGCTGACTCGCTGACATGCGACGACCGCGCTGCTATACGCAACCGAGTCGACTTG
TGGAGAAGACGAGATGCCCAAATGAACAAGACTGTCTTGTTTGTTGCCACGTCGAGCGAACCGTCAGGCTTGGCA
TACACACACAAGGGTCCCTGCAGGCTGGTGGCTTCGCGCATGACGCGCCTCGCCAAGGCAGCCTGCCGACTCATG
CGCAATCAAACGTGTCGACTCGAGGCTGCTTCCCTCTTCCAGTCGTCGCTCCGCGACTTTGACGTGCTTATTCGT
CTTTCGCCCAGAGCCGTCAAGGCCGCTGTCAGTGGCGCTGCCACGGCCGCCAGCGGCAAGCGACATTCGCATTTC
ACAAATATTCATATTGGTATCGGCAAGACGCCGTTGCCTCTGCGCCTACATCCGGTAGACGTGCTGGCAGCCGAA
CTACAACGCGTCTATCAGGACACGCTCGTCTTCTTTGGCGGCAGTAGCCAAGACTTGGTCTTGGCGGCGATTTGG
AATCCTAGGCTCCAGCATAGACAAAAGCCGAGAGCTGGTCTGCCGTACAACTTTTGTACCGAGCCCAATGCCAAT
GGATTCCATGGTGATGTTGTTGTAAACCGTGGTGCCATTCTCTTGGAAATTGCACGCGTGGGCGGCGACTTGATC
AAGGCGATCGAGGTGCTTGATGATTGCGGCACTGGCCAAGGCGACACGCAGTTGTAG
Transcript >OphauB2|2618
ATGGAGTGCCATTCGAAGCGTCGAAAGCTCAATCACATTGCTTCCAATGCTCCCTCCCATAGTCTCATCGACTTT
GAAGCCCGAAACTCGGCACAGCTGTCAGCGGCCAACACTCTTGTCCTCGAGGCCCATGACCTTTTGAACGAGTCA
CGACCCGACGCCAAAACCTTTGAGGGTGCTGACACTCTGCTCCGTCAAATCAAAGATATTATCGACTCGATTGAA
CCTCACGATGCTGTTCCAATTGCGCAAGCGACTGTCCAGCTCGAGAAAACGCACTGCGTTATTGCCCCCTATCCA
GACCCACCACCTCGTCCAGATGCACAATACAAAGTCTCGTTTGCCAAGCCGACGCAATGCAATGTCGTCGGCAGC
TACGTCTCCAAGTCGATGATCAAGGCTCAAGACTCTTTAGCCATTGACATGGTGGTTCAAATGCCCAAGTCGTTG
TTCCAAGACAAGGACTACATGGATATGCGCTACTTTTACCGCAGGAGCTATTATATCGCCTACATCGCGGCGCAC
GTGGGCAAACATCTTGGCAACATGTTCAAGTTGGCCTTTGAGCACCTCAACGAGAACCCTCTACTTCCTCTTCTC
CTCATTCGGCCTTTGGCTTCCAATCATGGCTGCCCGACCAGTGAAGCTCCACATGAGTGCAACACCCCTTATACT
ATCAGGCTGATACCTTGTGCTCCTCATCACCTTTTCCCCTGGTCCAAACTCACACCGTCGTCAAACTGTAATCGA
CAGCGCCACCAGAGTTGCTCTGTCCCGACCCCTTTTTACAACTCGACTCTTAATGGGGAGCAAGCATTCATACCA
TATCTCCGTTTCCTTTGCCAGGCCAGAAGCGTGTGCCCAGCCTTTGCAGATGCCTGCATCCTGGGAAGAATTTGG
CTTCAGCAGCGTGGGTTCGGTGGTGGCCTTTCCCAAGGCGGCTTTGGTCATTTTGAATGGGCTGTGCTTATGGCC
CTTTTATTGTCCACAGACGCCCGTGATGGAAAGGCGACTCTGTCAACGTCTCTAAGCAGCACCGAGCTTTTCAAG
GCTGTCATTCACTTCCTATCTACTACACATCTTTTGAAGAACCCTGTAGTCTTTGGCACATCTGGAGCAAATGCC
AAGGCTATTCAACAAGAGGGCCCTGTCATCTTTGATGGAGACAGGCAGCTCAACATTTTGTTCAAGACAACGCCA
TGGTCGATAGCCTTGCTCCAACTCTACGCAAAAATGACTACTGATTTGCTCGCGGACGACCCCGTGGACAAATTT
GATGCAATATTCATAAACAAGGCAGATATAGCTCCTCTAGTCTTTGATGCTTGCTTTGAGCTGTCCCTTGGAGCG
ACTACCGACAGACGCAACTTCAGCTTTAGGGCACATGGCATACTCAGACGCGCATATGGCTCACGTGCGCAGTTG
GTTCACTTCTCAACTCGGAAGCGTGAGCCTTGGCCTCTTGGGTGCAGAGCTCCCGACGAGACGTCAAACTTGACC
ATCAGCATCATATTTAACCCTGCTGAAATGTCTCGCAACATGGAGTACGGGCCTCGTGCTGAGGAACAAGAGGAA
GGCGCATCCTTCCGTCGATTTTGGGGCGAAAAGGCTGAACTACGACGCTTCAAAGACGGCAGAATTCTCGAATGT
GTTGAGTGGAAGATGGGATTGCCTTCTGAGATTTGTCACCAAGTCCTTTGCTACAGTCTCGGACGTCACATGGGC
ATCTCGAGTGACGATGTGGTGGTGCGAGGGCTCGATATGAGTACAATTATAGGCCCATGTCACCACGACAAGGAC
GCGTATGATGCTGCTAGGCGAGCATTTACGGTGCTGGAGCGCGAGATGCGCAGCCTGGAAGAGTTGCCACTCCAA
ATCAAGCAACTATGTCCTGTGTCGCCAATGGCCAGCTATTCGTCCACGCCGGTTCCAACACTGGCTTTCCATGGA
GACTTTTCAAAAGCCATGGACGTCATTGTATACTTTGAGGCTTCGAGCAAGTGGCCGGAAAATCTGGTTGCCATT
CAAGAAGCCAAGATTGAGTTTCTCCTTGACATTGACAAGAGGTTGATGGCAGCACATAGCAACATGACTACAAGC
CTTGGCCGGGAAAATGGCATCACGGCCATTGAGAACCTGGCCTACCTCGACATTGTCTACGATACGGGCGCTGCC
TTTCGGCTCAGGATACACTGTGACGTTGAGGAATCGCTGCTTGAGCGACAATCAAGGAATAAGACGCTCAATCAC
CACGTACGCGAAGCGTCGGCCCAAGCTCGAGACGAGTTTTGCTGGTTGTACAAGACACTGCCTCTACACACGCAG
ACAGTGGCTACACTATGTACCAGACTCGAGGCACTGTCTCAGTCAATACGGCTTGTCAAACACTGGTTTGCGAGC
CACATGCTGAGTCGCCACTTTAGCGAACAGCTCATTGAGCTTCTTGCACTTCACGTATTCCTGGAACCCTATCCC
TGGCCCGTCCCAACGTCCCCGACAACGGGCTTCCTGCGAATACTCTTGTTTCTCTCGCGATGGAATTGGAGGGAC
GAGCCTTTAATCATTGACTGGGCTGACTCGCTGACATGCGACGACCGCGCTGCTATACGCAACCGAGTCGACTTG
TGGAGAAGACGAGATGCCCAAATGAACAAGACTGTCTTGTTTGTTGCCACGTCGAGCGAACCGTCAGGCTTGGCA
TACACACACAAGGGTCCCTGCAGGCTGGTGGCTTCGCGCATGACGCGCCTCGCCAAGGCAGCCTGCCGACTCATG
CGCAATCAAACGTGTCGACTCGAGGCTGCTTCCCTCTTCCAGTCGTCGCTCCGCGACTTTGACGTGCTTATTCGT
CTTTCGCCCAGAGCCGTCAAGGCCGCTGTCAGTGGCGCTGCCACGGCCGCCAGCGGCAAGCGACATTCGCATTTC
ACAAATATTCATATTGGTATCGGCAAGACGCCGTTGCCTCTGCGCCTACATCCGGTAGACGTGCTGGCAGCCGAA
CTACAACGCGTCTATCAGGACACGCTCGTCTTCTTTGGCGGCAGTAGCCAAGACTTGGTCTTGGCGGCGATTTGG
AATCCTAGGCTCCAGCATAGACAAAAGCCGAGAGCTGGTCTGCCGTACAACTTTTGTACCGAGCCCAATGCCAAT
GGATTCCATGGTGATGTTGTTGTAAACCGTGGTGCCATTCTCTTGGAAATTGCACGCGTGGGCGGCGACTTGATC
AAGGCGATCGAGGTGCTTGATGATTGCGGCACTGGCCAAGGCGACACGCAGTTGTAG
Gene >OphauB2|2618
ATGGAGTGCCATTCGAAGCGTCGAAAGCTCAATCACATTGCTTCCAATGCTCCCTCCCATAGTCTCATCGACTTT
GAAGCCCGAAACTCGGCACAGCTGTCAGCGGCCAACACTCTTGTCCTCGAGGCCCATGACCTTTTGAACGAGTCA
CGACCCGACGCCAAAACCTTTGAGGGTGCTGACACTCTGCTCCGTCAAATCAAAGATATTATCGACTCGATTGAA
CCTCACGATGCTGTTCCAGTTAGTCTTGCTAGGCTACTAATGCCACAAGCTTTTGGCCATTGACCATTGCCATCT
AGATTGCGCAAGCGACTGTCCAGCTCGAGAAAACGCACTGCGTTATTGCCCCCTATCCAGACCCACCACCTCGTC
CAGATGCACAATACAAAGTCTCGTTTGCCAAGCCGACGCAATGCAATGTCGTCGGCAGCTACGTCTCCAAGTCGA
TGATCAAGGCTCAAGACTCTTTAGCCATTGACATGGTGGTTCAAATGCCCAAGTCGTTGTTCCAAGACAAGGACT
ACATGGATATGCGCTACTTTTACCGCAGGAGCTATTATATCGCCTACATCGCGGCGCACGTGGGCAAACATCTTG
GCAACATGTTCAAGTTGGCCTTTGAGCACCTCAACGAGAACCCTCTACTTCCTCTTCTCCTCATTCGGCCTTTGG
CTTCCAATCATGGCTGCCCGACCAGTGAAGCTCCACATGAGTGCAACACCCCTTATACTATCAGGCTGATACCTT
GTGCTCCTCATCACCTTTTCCCCTGGTCCAAACTCACACCGTCGTCAAACTGTAATCGACAGCGCCACCAGAGTT
GCTCTGTCCCGACCCCTTTTTACAACTCGACTCTTAATGGGGAGCAAGCATTCATACCATATCTCCGTTTCCTTT
GCCAGGCCAGAAGCGTGTGCCCAGCCTTTGCAGATGCCTGCATCCTGGGAAGAATTTGGCTTCAGCAGCGTGGGT
TCGGTGGTGGCCTTTCCCAAGGCGGCTTTGGTCATTTTGAATGGGCTGTGCTTATGGCCCTTTTATTGTCCACAG
ACGCCCGTGATGGAAAGGCGACTCTGTCAACGTCTCTAAGCAGCACCGAGCTTTTCAAGGCTGTCATTCACTTCC
TATCTACTACACATCTTTTGAAGAACCCTGTAGTCTTTGGCACATCTGGAGCAAATGCCAAGGCTATTCAACAAG
AGGGCCCTGTCATCTTTGATGGAGACAGGCAGCTCAACATTTTGTTCAAGACAACGCCATGGTCGATAGCCTTGC
TCCAACTCTACGCAAAAATGACTACTGATTTGCTCGCGGACGACCCCGTGGACAAATTTGATGCAATATTCATAA
ACAAGGCAGATATAGCTCCTCTAGTCTTTGATGCTTGCTTTGAGCTGTCCCTTGGAGCGACTACCGACAGACGCA
ACTTCAGCTTTAGGGCACATGGCATACTCAGACGCGCATATGGCTCACGTGCGCAGTTGGTTCACTTCTCAACTC
GGAAGCGTGAGCCTTGGCCTCTTGGGTGCAGAGCTCCCGACGAGACGTCAAACTTGACCATCAGCATCATATTTA
ACCCTGCTGAAATGTCTCGCAACATGGAGTACGGGCCTCGTGCTGAGGAACAAGAGGAAGGCGCATCCTTCCGTC
GATTTTGGGGCGAAAAGGCTGAACTACGACGCTTCAAAGACGGCAGAATTCTCGAATGTGTTGAGTGGAAGATGG
GATTGCCTTCTGAGATTTGTCACCAAGTCCTTTGCTACAGTCTCGGACGTCACATGGGCATCTCGAGTGACGATG
TGGTGGTGCGAGGGCTCGATATGAGTACAATTATAGGCCCATGTCACCACGACAAGGACGCGTATGATGCTGCTA
GGCGAGCATTTACGGTGCTGGAGCGCGAGATGCGCAGCCTGGAAGAGTTGCCACTCCAAATCAAGCAACTATGTC
CTGTGTCGCCAATGGCCAGCTATTCGTCCACGCCGGTTCCAACACTGGCTTTCCATGGAGACTTTTCAAAAGCCA
TGGACGTCATTGTATACTTTGAGGCTTCGAGCAAGTGGCCGGAAAATCTGGTTGCCATTCAAGAAGCCAAGATTG
AGTTTCTCCTTGACATTGACAAGAGGTTGATGGCAGCACATAGCAACATGACTACAAGCCTTGGCCGGGAAAATG
GCATCACGGCCATTGAGAACCTGGCCTACCTCGACATTGTCTACGATACGGGCGCTGCCTTTCGGCTCAGGATAC
ACTGTGACGTTGAGGAATCGCTGCTTGAGCGACAATCAAGGAATAAGACGCTCAATCACCACGTACGCGAAGCGT
CGGCCCAAGCTCGAGACGAGTTTTGCTGGTTGTACAAGACACTGCCTCTACACACGCAGACAGTGGCTACACTAT
GTACCAGACTCGAGGCACTGTCTCAGTCAATACGGCTTGTCAAACACTGGTTTGCGAGCCACATGCTGAGTCGCC
ACTTTAGCGAACAGCTCATTGAGCTTCTTGCACTTCACGTATTCCTGGAACCCTATCCCTGGCCCGTCCCAACGT
CCCCGACAACGGGCTTCCTGCGAATACTCTTGTTTCTCTCGCGATGGAATTGGAGGGACGAGCCTTTAATCATTG
ACTGGGCTGACTCGCTGACATGCGACGACCGCGCTGCTATACGCAACCGAGTCGACTTGTGGAGAAGACGAGATG
CCCAAATGAACAAGACTGTCTTGTTTGTTGCCACGTCGAGCGAACCGTCAGGCTTGGCATACACACACAAGGGTC
CCTGCAGGCTGGTGGCTTCGCGCATGACGCGCCTCGCCAAGGCAGCCTGCCGACTCATGCGCAATCAAACGTGTC
GACTCGAGGCTGCTTCCCTCTTCCAGTCGTCGCTCCGCGACTTTGACGTGCTTATTCGTCTTTCGCCCAGAGCCG
TCAAGGCCGCTGTCAGTGGCGCTGCCACGGCCGCCAGCGGCAAGCGACATTCGCATTTCACAAATATTCATATTG
GTATCGGCAAGACGCCGTTGCCTCTGCGCCTACATCCGGTAGACGTGCTGGCAGCCGAACTACAACGCGTCTATC
AGGACACGCTCGTCTTCTTTGGCGGCAGTAGCCAAGACTTGGTCTTGGCGGCGATTTGGAATCCTAGGCTCCAGC
ATAGACAAAAGCCGAGAGCTGGTCTGCCGTACAACTTTTGTACCGAGCCCAATGCCAATGGATTCCATGGTGATG
TTGTTGTAAACCGTGGTGCCATTCTCTTGGAAATTGCACGCGTGGGCGGCGACTTGATCAAGGCGATCGAGGTGC
TTGATGATTGCGGCACTGGCCAAGGCGACACGCAGTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail