Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2618
Gene name
LocationContig_184:27091..30432
Strand-
Gene length (bp)3341
Transcript length (bp)3282
Coding sequence length (bp)3282
Protein length (aa) 1094

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17406 Nrap_D5 Nrap protein PAP/OAS1-like domain 5 3.3E-56 785 939
PF17405 Nrap_D4 Nrap protein nucleotidyltransferase domain 4 5.5E-53 596 782
PF17403 Nrap_D2 Nrap protein PAP/OAS-like domain 1.3E-45 289 432
PF03813 Nrap Nrap protein domain 1 1.7E-41 140 283
PF17404 Nrap_D3 Nrap protein domain 3 7.0E-35 455 574
PF17407 Nrap_D6 Nrap protein domain 6 2.1E-27 942 1078

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94676|UTP22_SCHPO U3 small nucleolar RNA-associated protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp22 PE=3 SV=1 5 1080 5.0E-134
sp|P53254|UTP22_YEAST U3 small nucleolar RNA-associated protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP22 PE=1 SV=1 27 1080 2.0E-120
sp|Q8R5K4|NOL6_MOUSE Nucleolar protein 6 OS=Mus musculus GN=Nol6 PE=2 SV=2 28 1079 5.0E-88
sp|Q9H6R4|NOL6_HUMAN Nucleolar protein 6 OS=Homo sapiens GN=NOL6 PE=1 SV=2 28 1079 1.0E-84
sp|Q6NRY2|NOL6_XENLA Nucleolar protein 6 OS=Xenopus laevis GN=nol6 PE=2 SV=2 28 1079 2.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94676|UTP22_SCHPO U3 small nucleolar RNA-associated protein 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp22 PE=3 SV=1 5 1080 5.0E-134
sp|P53254|UTP22_YEAST U3 small nucleolar RNA-associated protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP22 PE=1 SV=1 27 1080 2.0E-120
sp|Q8R5K4|NOL6_MOUSE Nucleolar protein 6 OS=Mus musculus GN=Nol6 PE=2 SV=2 28 1079 5.0E-88
sp|Q9H6R4|NOL6_HUMAN Nucleolar protein 6 OS=Homo sapiens GN=NOL6 PE=1 SV=2 28 1079 1.0E-84
sp|Q6NRY2|NOL6_XENLA Nucleolar protein 6 OS=Xenopus laevis GN=nol6 PE=2 SV=2 28 1079 2.0E-75
sp|Q5M7P5|NOL6_XENTR Nucleolar protein 6 OS=Xenopus tropicalis GN=nol6 PE=2 SV=1 28 1079 1.0E-67
sp|B4NIM9|NOL6_DROWI Nucleolar protein 6 OS=Drosophila willistoni GN=Mat89Ba PE=3 SV=1 26 1027 3.0E-51
sp|Q295U7|NOL6_DROPS Nucleolar protein 6 OS=Drosophila pseudoobscura pseudoobscura GN=Mat89Ba PE=3 SV=2 114 1027 6.0E-51
sp|B4GFN6|NOL6_DROPE Nucleolar protein 6 OS=Drosophila persimilis GN=Mat89Ba PE=3 SV=1 114 1027 1.0E-50
sp|B4PR18|NOL6_DROYA Nucleolar protein 6 OS=Drosophila yakuba GN=Mat89Ba PE=3 SV=1 26 1051 4.0E-48
sp|B4QX57|NOL6_DROSI Nucleolar protein 6 OS=Drosophila simulans GN=Mat89Ba PE=3 SV=1 26 1051 4.0E-46
sp|Q8IH00|NOL6_DROME Nucleolar protein 6 OS=Drosophila melanogaster GN=Mat89Ba PE=1 SV=1 26 1035 4.0E-46
sp|B4IBY3|NOL6_DROSE Nucleolar protein 6 OS=Drosophila sechellia GN=Mat89Ba PE=3 SV=1 26 1051 1.0E-44
sp|B4LWT7|NOL6_DROVI Nucleolar protein 6 OS=Drosophila virilis GN=Mat89Ba PE=3 SV=1 5 1035 9.0E-44
sp|B4K5S6|NOL6_DROMO Nucleolar protein 6 OS=Drosophila mojavensis GN=Mat89Ba PE=3 SV=1 110 1035 5.0E-41
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2618
MECHSKRRKLNHIASNAPSHSLIDFEARNSAQLSAANTLVLEAHDLLNESRPDAKTFEGADTLLRQIKDIIDSIE
PHDAVPIAQATVQLEKTHCVIAPYPDPPPRPDAQYKVSFAKPTQCNVVGSYVSKSMIKAQDSLAIDMVVQMPKSL
FQDKDYMDMRYFYRRSYYIAYIAAHVGKHLGNMFKLAFEHLNENPLLPLLLIRPLASNHGCPTSEAPHECNTPYT
IRLIPCAPHHLFPWSKLTPSSNCNRQRHQSCSVPTPFYNSTLNGEQAFIPYLRFLCQARSVCPAFADACILGRIW
LQQRGFGGGLSQGGFGHFEWAVLMALLLSTDARDGKATLSTSLSSTELFKAVIHFLSTTHLLKNPVVFGTSGANA
KAIQQEGPVIFDGDRQLNILFKTTPWSIALLQLYAKMTTDLLADDPVDKFDAIFINKADIAPLVFDACFELSLGA
TTDRRNFSFRAHGILRRAYGSRAQLVHFSTRKREPWPLGCRAPDETSNLTISIIFNPAEMSRNMEYGPRAEEQEE
GASFRRFWGEKAELRRFKDGRILECVEWKMGLPSEICHQVLCYSLGRHMGISSDDVVVRGLDMSTIIGPCHHDKD
AYDAARRAFTVLEREMRSLEELPLQIKQLCPVSPMASYSSTPVPTLAFHGDFSKAMDVIVYFEASSKWPENLVAI
QEAKIEFLLDIDKRLMAAHSNMTTSLGRENGITAIENLAYLDIVYDTGAAFRLRIHCDVEESLLERQSRNKTLNH
HVREASAQARDEFCWLYKTLPLHTQTVATLCTRLEALSQSIRLVKHWFASHMLSRHFSEQLIELLALHVFLEPYP
WPVPTSPTTGFLRILLFLSRWNWRDEPLIIDWADSLTCDDRAAIRNRVDLWRRRDAQMNKTVLFVATSSEPSGLA
YTHKGPCRLVASRMTRLAKAACRLMRNQTCRLEAASLFQSSLRDFDVLIRLSPRAVKAAVSGAATAASGKRHSHF
TNIHIGIGKTPLPLRLHPVDVLAAELQRVYQDTLVFFGGSSQDLVLAAIWNPRLQHRQKPRAGLPYNFCTEPNAN
GFHGDVVVNRGAILLEIARVGGDLIKAIEVLDDCGTGQGDTQL*
Coding >OphauB2|2618
ATGGAGTGCCATTCGAAGCGTCGAAAGCTCAATCACATTGCTTCCAATGCTCCCTCCCATAGTCTCATCGACTTT
GAAGCCCGAAACTCGGCACAGCTGTCAGCGGCCAACACTCTTGTCCTCGAGGCCCATGACCTTTTGAACGAGTCA
CGACCCGACGCCAAAACCTTTGAGGGTGCTGACACTCTGCTCCGTCAAATCAAAGATATTATCGACTCGATTGAA
CCTCACGATGCTGTTCCAATTGCGCAAGCGACTGTCCAGCTCGAGAAAACGCACTGCGTTATTGCCCCCTATCCA
GACCCACCACCTCGTCCAGATGCACAATACAAAGTCTCGTTTGCCAAGCCGACGCAATGCAATGTCGTCGGCAGC
TACGTCTCCAAGTCGATGATCAAGGCTCAAGACTCTTTAGCCATTGACATGGTGGTTCAAATGCCCAAGTCGTTG
TTCCAAGACAAGGACTACATGGATATGCGCTACTTTTACCGCAGGAGCTATTATATCGCCTACATCGCGGCGCAC
GTGGGCAAACATCTTGGCAACATGTTCAAGTTGGCCTTTGAGCACCTCAACGAGAACCCTCTACTTCCTCTTCTC
CTCATTCGGCCTTTGGCTTCCAATCATGGCTGCCCGACCAGTGAAGCTCCACATGAGTGCAACACCCCTTATACT
ATCAGGCTGATACCTTGTGCTCCTCATCACCTTTTCCCCTGGTCCAAACTCACACCGTCGTCAAACTGTAATCGA
CAGCGCCACCAGAGTTGCTCTGTCCCGACCCCTTTTTACAACTCGACTCTTAATGGGGAGCAAGCATTCATACCA
TATCTCCGTTTCCTTTGCCAGGCCAGAAGCGTGTGCCCAGCCTTTGCAGATGCCTGCATCCTGGGAAGAATTTGG
CTTCAGCAGCGTGGGTTCGGTGGTGGCCTTTCCCAAGGCGGCTTTGGTCATTTTGAATGGGCTGTGCTTATGGCC
CTTTTATTGTCCACAGACGCCCGTGATGGAAAGGCGACTCTGTCAACGTCTCTAAGCAGCACCGAGCTTTTCAAG
GCTGTCATTCACTTCCTATCTACTACACATCTTTTGAAGAACCCTGTAGTCTTTGGCACATCTGGAGCAAATGCC
AAGGCTATTCAACAAGAGGGCCCTGTCATCTTTGATGGAGACAGGCAGCTCAACATTTTGTTCAAGACAACGCCA
TGGTCGATAGCCTTGCTCCAACTCTACGCAAAAATGACTACTGATTTGCTCGCGGACGACCCCGTGGACAAATTT
GATGCAATATTCATAAACAAGGCAGATATAGCTCCTCTAGTCTTTGATGCTTGCTTTGAGCTGTCCCTTGGAGCG
ACTACCGACAGACGCAACTTCAGCTTTAGGGCACATGGCATACTCAGACGCGCATATGGCTCACGTGCGCAGTTG
GTTCACTTCTCAACTCGGAAGCGTGAGCCTTGGCCTCTTGGGTGCAGAGCTCCCGACGAGACGTCAAACTTGACC
ATCAGCATCATATTTAACCCTGCTGAAATGTCTCGCAACATGGAGTACGGGCCTCGTGCTGAGGAACAAGAGGAA
GGCGCATCCTTCCGTCGATTTTGGGGCGAAAAGGCTGAACTACGACGCTTCAAAGACGGCAGAATTCTCGAATGT
GTTGAGTGGAAGATGGGATTGCCTTCTGAGATTTGTCACCAAGTCCTTTGCTACAGTCTCGGACGTCACATGGGC
ATCTCGAGTGACGATGTGGTGGTGCGAGGGCTCGATATGAGTACAATTATAGGCCCATGTCACCACGACAAGGAC
GCGTATGATGCTGCTAGGCGAGCATTTACGGTGCTGGAGCGCGAGATGCGCAGCCTGGAAGAGTTGCCACTCCAA
ATCAAGCAACTATGTCCTGTGTCGCCAATGGCCAGCTATTCGTCCACGCCGGTTCCAACACTGGCTTTCCATGGA
GACTTTTCAAAAGCCATGGACGTCATTGTATACTTTGAGGCTTCGAGCAAGTGGCCGGAAAATCTGGTTGCCATT
CAAGAAGCCAAGATTGAGTTTCTCCTTGACATTGACAAGAGGTTGATGGCAGCACATAGCAACATGACTACAAGC
CTTGGCCGGGAAAATGGCATCACGGCCATTGAGAACCTGGCCTACCTCGACATTGTCTACGATACGGGCGCTGCC
TTTCGGCTCAGGATACACTGTGACGTTGAGGAATCGCTGCTTGAGCGACAATCAAGGAATAAGACGCTCAATCAC
CACGTACGCGAAGCGTCGGCCCAAGCTCGAGACGAGTTTTGCTGGTTGTACAAGACACTGCCTCTACACACGCAG
ACAGTGGCTACACTATGTACCAGACTCGAGGCACTGTCTCAGTCAATACGGCTTGTCAAACACTGGTTTGCGAGC
CACATGCTGAGTCGCCACTTTAGCGAACAGCTCATTGAGCTTCTTGCACTTCACGTATTCCTGGAACCCTATCCC
TGGCCCGTCCCAACGTCCCCGACAACGGGCTTCCTGCGAATACTCTTGTTTCTCTCGCGATGGAATTGGAGGGAC
GAGCCTTTAATCATTGACTGGGCTGACTCGCTGACATGCGACGACCGCGCTGCTATACGCAACCGAGTCGACTTG
TGGAGAAGACGAGATGCCCAAATGAACAAGACTGTCTTGTTTGTTGCCACGTCGAGCGAACCGTCAGGCTTGGCA
TACACACACAAGGGTCCCTGCAGGCTGGTGGCTTCGCGCATGACGCGCCTCGCCAAGGCAGCCTGCCGACTCATG
CGCAATCAAACGTGTCGACTCGAGGCTGCTTCCCTCTTCCAGTCGTCGCTCCGCGACTTTGACGTGCTTATTCGT
CTTTCGCCCAGAGCCGTCAAGGCCGCTGTCAGTGGCGCTGCCACGGCCGCCAGCGGCAAGCGACATTCGCATTTC
ACAAATATTCATATTGGTATCGGCAAGACGCCGTTGCCTCTGCGCCTACATCCGGTAGACGTGCTGGCAGCCGAA
CTACAACGCGTCTATCAGGACACGCTCGTCTTCTTTGGCGGCAGTAGCCAAGACTTGGTCTTGGCGGCGATTTGG
AATCCTAGGCTCCAGCATAGACAAAAGCCGAGAGCTGGTCTGCCGTACAACTTTTGTACCGAGCCCAATGCCAAT
GGATTCCATGGTGATGTTGTTGTAAACCGTGGTGCCATTCTCTTGGAAATTGCACGCGTGGGCGGCGACTTGATC
AAGGCGATCGAGGTGCTTGATGATTGCGGCACTGGCCAAGGCGACACGCAGTTGTAG
Transcript >OphauB2|2618
ATGGAGTGCCATTCGAAGCGTCGAAAGCTCAATCACATTGCTTCCAATGCTCCCTCCCATAGTCTCATCGACTTT
GAAGCCCGAAACTCGGCACAGCTGTCAGCGGCCAACACTCTTGTCCTCGAGGCCCATGACCTTTTGAACGAGTCA
CGACCCGACGCCAAAACCTTTGAGGGTGCTGACACTCTGCTCCGTCAAATCAAAGATATTATCGACTCGATTGAA
CCTCACGATGCTGTTCCAATTGCGCAAGCGACTGTCCAGCTCGAGAAAACGCACTGCGTTATTGCCCCCTATCCA
GACCCACCACCTCGTCCAGATGCACAATACAAAGTCTCGTTTGCCAAGCCGACGCAATGCAATGTCGTCGGCAGC
TACGTCTCCAAGTCGATGATCAAGGCTCAAGACTCTTTAGCCATTGACATGGTGGTTCAAATGCCCAAGTCGTTG
TTCCAAGACAAGGACTACATGGATATGCGCTACTTTTACCGCAGGAGCTATTATATCGCCTACATCGCGGCGCAC
GTGGGCAAACATCTTGGCAACATGTTCAAGTTGGCCTTTGAGCACCTCAACGAGAACCCTCTACTTCCTCTTCTC
CTCATTCGGCCTTTGGCTTCCAATCATGGCTGCCCGACCAGTGAAGCTCCACATGAGTGCAACACCCCTTATACT
ATCAGGCTGATACCTTGTGCTCCTCATCACCTTTTCCCCTGGTCCAAACTCACACCGTCGTCAAACTGTAATCGA
CAGCGCCACCAGAGTTGCTCTGTCCCGACCCCTTTTTACAACTCGACTCTTAATGGGGAGCAAGCATTCATACCA
TATCTCCGTTTCCTTTGCCAGGCCAGAAGCGTGTGCCCAGCCTTTGCAGATGCCTGCATCCTGGGAAGAATTTGG
CTTCAGCAGCGTGGGTTCGGTGGTGGCCTTTCCCAAGGCGGCTTTGGTCATTTTGAATGGGCTGTGCTTATGGCC
CTTTTATTGTCCACAGACGCCCGTGATGGAAAGGCGACTCTGTCAACGTCTCTAAGCAGCACCGAGCTTTTCAAG
GCTGTCATTCACTTCCTATCTACTACACATCTTTTGAAGAACCCTGTAGTCTTTGGCACATCTGGAGCAAATGCC
AAGGCTATTCAACAAGAGGGCCCTGTCATCTTTGATGGAGACAGGCAGCTCAACATTTTGTTCAAGACAACGCCA
TGGTCGATAGCCTTGCTCCAACTCTACGCAAAAATGACTACTGATTTGCTCGCGGACGACCCCGTGGACAAATTT
GATGCAATATTCATAAACAAGGCAGATATAGCTCCTCTAGTCTTTGATGCTTGCTTTGAGCTGTCCCTTGGAGCG
ACTACCGACAGACGCAACTTCAGCTTTAGGGCACATGGCATACTCAGACGCGCATATGGCTCACGTGCGCAGTTG
GTTCACTTCTCAACTCGGAAGCGTGAGCCTTGGCCTCTTGGGTGCAGAGCTCCCGACGAGACGTCAAACTTGACC
ATCAGCATCATATTTAACCCTGCTGAAATGTCTCGCAACATGGAGTACGGGCCTCGTGCTGAGGAACAAGAGGAA
GGCGCATCCTTCCGTCGATTTTGGGGCGAAAAGGCTGAACTACGACGCTTCAAAGACGGCAGAATTCTCGAATGT
GTTGAGTGGAAGATGGGATTGCCTTCTGAGATTTGTCACCAAGTCCTTTGCTACAGTCTCGGACGTCACATGGGC
ATCTCGAGTGACGATGTGGTGGTGCGAGGGCTCGATATGAGTACAATTATAGGCCCATGTCACCACGACAAGGAC
GCGTATGATGCTGCTAGGCGAGCATTTACGGTGCTGGAGCGCGAGATGCGCAGCCTGGAAGAGTTGCCACTCCAA
ATCAAGCAACTATGTCCTGTGTCGCCAATGGCCAGCTATTCGTCCACGCCGGTTCCAACACTGGCTTTCCATGGA
GACTTTTCAAAAGCCATGGACGTCATTGTATACTTTGAGGCTTCGAGCAAGTGGCCGGAAAATCTGGTTGCCATT
CAAGAAGCCAAGATTGAGTTTCTCCTTGACATTGACAAGAGGTTGATGGCAGCACATAGCAACATGACTACAAGC
CTTGGCCGGGAAAATGGCATCACGGCCATTGAGAACCTGGCCTACCTCGACATTGTCTACGATACGGGCGCTGCC
TTTCGGCTCAGGATACACTGTGACGTTGAGGAATCGCTGCTTGAGCGACAATCAAGGAATAAGACGCTCAATCAC
CACGTACGCGAAGCGTCGGCCCAAGCTCGAGACGAGTTTTGCTGGTTGTACAAGACACTGCCTCTACACACGCAG
ACAGTGGCTACACTATGTACCAGACTCGAGGCACTGTCTCAGTCAATACGGCTTGTCAAACACTGGTTTGCGAGC
CACATGCTGAGTCGCCACTTTAGCGAACAGCTCATTGAGCTTCTTGCACTTCACGTATTCCTGGAACCCTATCCC
TGGCCCGTCCCAACGTCCCCGACAACGGGCTTCCTGCGAATACTCTTGTTTCTCTCGCGATGGAATTGGAGGGAC
GAGCCTTTAATCATTGACTGGGCTGACTCGCTGACATGCGACGACCGCGCTGCTATACGCAACCGAGTCGACTTG
TGGAGAAGACGAGATGCCCAAATGAACAAGACTGTCTTGTTTGTTGCCACGTCGAGCGAACCGTCAGGCTTGGCA
TACACACACAAGGGTCCCTGCAGGCTGGTGGCTTCGCGCATGACGCGCCTCGCCAAGGCAGCCTGCCGACTCATG
CGCAATCAAACGTGTCGACTCGAGGCTGCTTCCCTCTTCCAGTCGTCGCTCCGCGACTTTGACGTGCTTATTCGT
CTTTCGCCCAGAGCCGTCAAGGCCGCTGTCAGTGGCGCTGCCACGGCCGCCAGCGGCAAGCGACATTCGCATTTC
ACAAATATTCATATTGGTATCGGCAAGACGCCGTTGCCTCTGCGCCTACATCCGGTAGACGTGCTGGCAGCCGAA
CTACAACGCGTCTATCAGGACACGCTCGTCTTCTTTGGCGGCAGTAGCCAAGACTTGGTCTTGGCGGCGATTTGG
AATCCTAGGCTCCAGCATAGACAAAAGCCGAGAGCTGGTCTGCCGTACAACTTTTGTACCGAGCCCAATGCCAAT
GGATTCCATGGTGATGTTGTTGTAAACCGTGGTGCCATTCTCTTGGAAATTGCACGCGTGGGCGGCGACTTGATC
AAGGCGATCGAGGTGCTTGATGATTGCGGCACTGGCCAAGGCGACACGCAGTTGTAG
Gene >OphauB2|2618
ATGGAGTGCCATTCGAAGCGTCGAAAGCTCAATCACATTGCTTCCAATGCTCCCTCCCATAGTCTCATCGACTTT
GAAGCCCGAAACTCGGCACAGCTGTCAGCGGCCAACACTCTTGTCCTCGAGGCCCATGACCTTTTGAACGAGTCA
CGACCCGACGCCAAAACCTTTGAGGGTGCTGACACTCTGCTCCGTCAAATCAAAGATATTATCGACTCGATTGAA
CCTCACGATGCTGTTCCAGTTAGTCTTGCTAGGCTACTAATGCCACAAGCTTTTGGCCATTGACCATTGCCATCT
AGATTGCGCAAGCGACTGTCCAGCTCGAGAAAACGCACTGCGTTATTGCCCCCTATCCAGACCCACCACCTCGTC
CAGATGCACAATACAAAGTCTCGTTTGCCAAGCCGACGCAATGCAATGTCGTCGGCAGCTACGTCTCCAAGTCGA
TGATCAAGGCTCAAGACTCTTTAGCCATTGACATGGTGGTTCAAATGCCCAAGTCGTTGTTCCAAGACAAGGACT
ACATGGATATGCGCTACTTTTACCGCAGGAGCTATTATATCGCCTACATCGCGGCGCACGTGGGCAAACATCTTG
GCAACATGTTCAAGTTGGCCTTTGAGCACCTCAACGAGAACCCTCTACTTCCTCTTCTCCTCATTCGGCCTTTGG
CTTCCAATCATGGCTGCCCGACCAGTGAAGCTCCACATGAGTGCAACACCCCTTATACTATCAGGCTGATACCTT
GTGCTCCTCATCACCTTTTCCCCTGGTCCAAACTCACACCGTCGTCAAACTGTAATCGACAGCGCCACCAGAGTT
GCTCTGTCCCGACCCCTTTTTACAACTCGACTCTTAATGGGGAGCAAGCATTCATACCATATCTCCGTTTCCTTT
GCCAGGCCAGAAGCGTGTGCCCAGCCTTTGCAGATGCCTGCATCCTGGGAAGAATTTGGCTTCAGCAGCGTGGGT
TCGGTGGTGGCCTTTCCCAAGGCGGCTTTGGTCATTTTGAATGGGCTGTGCTTATGGCCCTTTTATTGTCCACAG
ACGCCCGTGATGGAAAGGCGACTCTGTCAACGTCTCTAAGCAGCACCGAGCTTTTCAAGGCTGTCATTCACTTCC
TATCTACTACACATCTTTTGAAGAACCCTGTAGTCTTTGGCACATCTGGAGCAAATGCCAAGGCTATTCAACAAG
AGGGCCCTGTCATCTTTGATGGAGACAGGCAGCTCAACATTTTGTTCAAGACAACGCCATGGTCGATAGCCTTGC
TCCAACTCTACGCAAAAATGACTACTGATTTGCTCGCGGACGACCCCGTGGACAAATTTGATGCAATATTCATAA
ACAAGGCAGATATAGCTCCTCTAGTCTTTGATGCTTGCTTTGAGCTGTCCCTTGGAGCGACTACCGACAGACGCA
ACTTCAGCTTTAGGGCACATGGCATACTCAGACGCGCATATGGCTCACGTGCGCAGTTGGTTCACTTCTCAACTC
GGAAGCGTGAGCCTTGGCCTCTTGGGTGCAGAGCTCCCGACGAGACGTCAAACTTGACCATCAGCATCATATTTA
ACCCTGCTGAAATGTCTCGCAACATGGAGTACGGGCCTCGTGCTGAGGAACAAGAGGAAGGCGCATCCTTCCGTC
GATTTTGGGGCGAAAAGGCTGAACTACGACGCTTCAAAGACGGCAGAATTCTCGAATGTGTTGAGTGGAAGATGG
GATTGCCTTCTGAGATTTGTCACCAAGTCCTTTGCTACAGTCTCGGACGTCACATGGGCATCTCGAGTGACGATG
TGGTGGTGCGAGGGCTCGATATGAGTACAATTATAGGCCCATGTCACCACGACAAGGACGCGTATGATGCTGCTA
GGCGAGCATTTACGGTGCTGGAGCGCGAGATGCGCAGCCTGGAAGAGTTGCCACTCCAAATCAAGCAACTATGTC
CTGTGTCGCCAATGGCCAGCTATTCGTCCACGCCGGTTCCAACACTGGCTTTCCATGGAGACTTTTCAAAAGCCA
TGGACGTCATTGTATACTTTGAGGCTTCGAGCAAGTGGCCGGAAAATCTGGTTGCCATTCAAGAAGCCAAGATTG
AGTTTCTCCTTGACATTGACAAGAGGTTGATGGCAGCACATAGCAACATGACTACAAGCCTTGGCCGGGAAAATG
GCATCACGGCCATTGAGAACCTGGCCTACCTCGACATTGTCTACGATACGGGCGCTGCCTTTCGGCTCAGGATAC
ACTGTGACGTTGAGGAATCGCTGCTTGAGCGACAATCAAGGAATAAGACGCTCAATCACCACGTACGCGAAGCGT
CGGCCCAAGCTCGAGACGAGTTTTGCTGGTTGTACAAGACACTGCCTCTACACACGCAGACAGTGGCTACACTAT
GTACCAGACTCGAGGCACTGTCTCAGTCAATACGGCTTGTCAAACACTGGTTTGCGAGCCACATGCTGAGTCGCC
ACTTTAGCGAACAGCTCATTGAGCTTCTTGCACTTCACGTATTCCTGGAACCCTATCCCTGGCCCGTCCCAACGT
CCCCGACAACGGGCTTCCTGCGAATACTCTTGTTTCTCTCGCGATGGAATTGGAGGGACGAGCCTTTAATCATTG
ACTGGGCTGACTCGCTGACATGCGACGACCGCGCTGCTATACGCAACCGAGTCGACTTGTGGAGAAGACGAGATG
CCCAAATGAACAAGACTGTCTTGTTTGTTGCCACGTCGAGCGAACCGTCAGGCTTGGCATACACACACAAGGGTC
CCTGCAGGCTGGTGGCTTCGCGCATGACGCGCCTCGCCAAGGCAGCCTGCCGACTCATGCGCAATCAAACGTGTC
GACTCGAGGCTGCTTCCCTCTTCCAGTCGTCGCTCCGCGACTTTGACGTGCTTATTCGTCTTTCGCCCAGAGCCG
TCAAGGCCGCTGTCAGTGGCGCTGCCACGGCCGCCAGCGGCAAGCGACATTCGCATTTCACAAATATTCATATTG
GTATCGGCAAGACGCCGTTGCCTCTGCGCCTACATCCGGTAGACGTGCTGGCAGCCGAACTACAACGCGTCTATC
AGGACACGCTCGTCTTCTTTGGCGGCAGTAGCCAAGACTTGGTCTTGGCGGCGATTTGGAATCCTAGGCTCCAGC
ATAGACAAAAGCCGAGAGCTGGTCTGCCGTACAACTTTTGTACCGAGCCCAATGCCAATGGATTCCATGGTGATG
TTGTTGTAAACCGTGGTGCCATTCTCTTGGAAATTGCACGCGTGGGCGGCGACTTGATCAAGGCGATCGAGGTGC
TTGATGATTGCGGCACTGGCCAAGGCGACACGCAGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail